SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0L1Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0L1Q8
Domain Number 1 Region: 157-229
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.000000000000173
Family Exocyst complex component 0.0055
Further Details:      
 
Weak hits

Sequence:  A0A0E0L1Q8
Domain Number - Region: 48-153
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0046
Family Exocyst complex component 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0L1Q8
Sequence length 230
Comment (tr|A0A0E0L1Q8|A0A0E0L1Q8_ORYPU) Uncharacterized protein {ECO:0000313|EnsemblPlants:OPUNC05G12120.1} KW=Complete proteome; Reference proteome OX=4537 OS=Oryza punctata (Red rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MVLVKLRSRWSMTGSWTTVSKMLTFANALAAAGNTWRPIDEFSWLMDVQICTSHVSEILV
PSLKKETLWPTYSEEMQSLLNQIGNVVSTTKNDLGKAIERMTNDAEAVTPVLSGRDSWEN
FPRSAEIHKATHLIMDYARLFQGYHHELHSIVHYGHLARFASEFQTTCGHQKLWKVSNPE
LRKSLRKAIVDMVITGPIGYKKYLEDHPEQDKCSRNPQDMEDMVNELFEG
Download sequence
Identical sequences A0A0E0L1Q8
OPUNC05G12120.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]