SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0LG12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0LG12
Domain Number 1 Region: 35-183
Classification Level Classification E-value
Superfamily ThiG-like 8.37e-34
Family ThiG-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0LG12
Sequence length 209
Comment (tr|A0A0E0LG12|A0A0E0LG12_ORYPU) Uncharacterized protein {ECO:0000313|EnsemblPlants:OPUNC07G00010.1} KW=Complete proteome; Reference proteome OX=4537 OS=Oryza punctata (Red rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MATDGTGVVTVYGSGTNGAALLEPSNHKSATFSVKVGLAQMLRGGVIMDVVTPEQARIAE
EAGACAVMALERVPADIRAQGGVARMSDPGLIRDIKRAVTIPVMAKARIGHFVEAQILEA
IGIDYVDESEVLTLADDAHHINKHNFRVPFVCGIFKSGDPARRARAIVQAVTHYSDPKIL
AEVSSGLGEAMVGINLSDPKVERFAARSE
Download sequence
Identical sequences A0A0E0LG12
OPUNC07G00010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]