SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0LYU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0LYU2
Domain Number 1 Region: 53-158
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 7.15e-32
Family Insert subdomain of RNA polymerase alpha subunit 0.00061
Further Details:      
 
Domain Number 2 Region: 22-53,162-209
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 0.00000000000000102
Family RNA polymerase alpha subunit dimerisation domain 0.022
Further Details:      
 
Domain Number 3 Region: 223-256
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.0000000222
Family C-terminal domain of RNA polymerase alpha subunit 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0LYU2
Sequence length 259
Comment (tr|A0A0E0LYU2|A0A0E0LYU2_ORYPU) Uncharacterized protein {ECO:0000313|EnsemblPlants:OPUNC09G01990.1} KW=Complete proteome; Reference proteome OX=4537 OS=Oryza punctata (Red rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MGVDLRHSRIHSNTTVEIVSVFISRLILSPLRKGQADTVGIALQRALLGETEGPCITHAK
FGSVPHEYSTIAGIEESVQEILLNLKEIVLRSNLYGVRNVSICVKGPRYITAQDIILPSS
VEIVDTALPIANLTEPTDFRIKLRIKRDRGYHTEVRKNTQDGIFFSGGNGNAKYEILFLE
IWTNGSLTPKEALYEASRNLIDLFFPFLHTEEEGTRFQESKNRTYNCLKRANIHTLLDLL
TKMEEDIMRIDGFRMQDGK
Download sequence
Identical sequences A0A0E0LYU2
OPUNC09G01990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]