SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0PB25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E0PB25
Domain Number - Region: 16-50
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00984
Family B-box zinc-binding domain 0.0062
Further Details:      
 
Domain Number - Region: 55-92
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0885
Family B-box zinc-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0PB25
Sequence length 333
Comment (tr|A0A0E0PB25|A0A0E0PB25_ORYRU) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI04G18920.1} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MEGDDKSAVVGGAYWGLAARACDACGGEAARLFCRADAAFLCAGCDARAHGPGSRHARVW
LCEVCEHAPAAVTCRADAAALCAACDADIHSANPLARRHERLPVAPFFGALADAPKPGSG
AHGGDAAAADDDGSNDAEAASWLLPEPDHGQKDGAVGATDELYADSDPYLDLDFARSMDD
IKAIGVQNGPPELDITGGKLFYSDHSMNHSVSSSEAAVVPDAAAGGGAPMPVVSRGRERE
ARLMRYREKRKSRRFEKTIRYASRKAYAETRPRIKGRFAKRTKGGAGADADADADADGED
EEMYSSAAAAVAALMAPGGSDADYGVDGVVPTF
Download sequence
Identical sequences A0A0E0PB25 I1PMN9 Q7XQH7
XP_015633841.1.37577 LOC_Os04g42020.1|PACid:21894507 39947.LOC_Os04g42020.1 ORGLA04G0145800.1 LOC_Os04g42020.1|13104.m04134|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]