SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0R220 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0R220
Domain Number 1 Region: 27-183
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 1.96e-63
Family Bacterial photosystem II reaction centre, L and M subunits 0.0000000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0R220
Sequence length 193
Comment (tr|A0A0E0R220|A0A0E0R220_ORYRU) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI10G18630.1} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MGEERERESTSLWGRFCNWITSTENPATAVFLIYPIGQGSFFDGMPLGISGTFNFMIVFQ
ADHNILMHLFHMLGVAGVFGGSLFSAMHGSLVTSSLIGETTENESANEGYRFGQEEETYN
IVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPPINTWADIINRANLGMEVMHERNAHNFP
LDLAALEVPSLNR
Download sequence
Identical sequences A0A0E0R220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]