SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E0SZ68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0SZ68
Domain Number 1 Region: 15-209
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-34
Family Pyruvate oxidase and decarboxylase Pyr module 0.034
Further Details:      
 
Domain Number 2 Region: 638-831
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.14e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 
Domain Number 3 Region: 286-538
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.2e-23
Family Pyruvate oxidase and decarboxylase PP module 0.027
Further Details:      
 
Domain Number 4 Region: 547-645
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000942
Family Ferredoxin domains from multidomain proteins 0.066
Further Details:      
 
Domain Number 5 Region: 239-305
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000707
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0SZ68
Sequence length 832
Comment (tr|A0A0E0SZ68|A0A0E0SZ68_DESVR) Pyruvate/ketoisovalerate oxidoreductase, catalytic domain protein {ECO:0000313|EMBL:ADP85509.1} KW=Complete proteome OX=573059 OS=Desulfovibrio vulgaris (strain RCH1). GN=Deval_0338 OC=Desulfovibrionaceae; Desulfovibrio.
Sequence
MNAIKQLCTQNAGEAAVLQGNIAFAAGCVRSGIHAVDGYPGTPSTEVIDKGLSNVQDMIK
VGWSVSEAVAVSMGHGHSLAGEDCIVTMKIPGLFQAGDPFSSSAFFTEDRGALVYYLASD
FTPSSTQHLVDPRPFIRSCFTPIFEPRNHQEMHEAAEIAADISRQYKTPVVILASGTLCH
SEGLVRLSEIRTRERVVSSVPLKAFNTLPVTARRNYDKVVTERMPALADMVEKSPLNVWE
RGSRKVGVITFGVGEMMVREVKQALGEDIDILSLGFTCPLPMNLIREFHASIEGDVYVVE
DGYRYLQEELERAGLAVKGKSPADTVTEWDPAGIAALLGYSLKSPAASDVAPLPRAPMIC
AGCPYRLFGETVRSMKKRGKIEACFGDIGCNTLLYFMDAMDTNVAMGAGEAHRAGFIVAN
PDKAAKCISLLGDGTECHSGMDATRNTIFRHIAGVKVVLDNNWTAMTGGQPGPTSPVNLA
GQENTFDLQASLKAHGAKVVVVNGYDRKGIRTALTSALEDAANGEFTTMVVTGVCIRKMP
KSAYGTRMTVDADLCKRCGQCQICPGISADAEGLPSFNNLCSGCVSQNAACGQMCPVHAI
KAAEAVDTRATARVELPKAPEEIAMPAPGSFTLPEKIAVAIRGVGGQGNLFFGRVLTQLA
FLAGYGDTNVVKGETHGMAQMGGPVISTFSCGKVVSPVLLPGTADCLVSMEMSEVLRPGY
VGMLRPGGTVLLADTRVLPYGVSEDAYPHRDAILGTLDGYNVIIIDVLKAALELGDPTGR
IANVVMIGALSTLAPFDGFPAELWLQALRNVSPKPAIWTANHAAFNVGRGLL
Download sequence
Identical sequences A0A0E0SZ68 Q72F41
WP_010937681.1.14085 YP_009598.1.77684 gi|46578790|ref|YP_009598.1| 882.DVU0374 gi|387152211|ref|YP_005701147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]