SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E0T344 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0T344
Domain Number 1 Region: 167-354
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.88e-70
Family Methylesterase CheB, C-terminal domain 0.00000105
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily CheY-like 3.13e-28
Family CheY-related 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0T344
Sequence length 357
Comment (tr|A0A0E0T344|A0A0E0T344_DESVR) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=573059 OS=Desulfovibrio vulgaris (strain RCH1). GN=Deval_1698 OC=Desulfovibrionaceae; Desulfovibrio.
Sequence
MARPCRVLIVDDSALVRQTLADLLSADPGIEVVGTASDPFVAAKRMEAVVPDVILLDIEM
PRMDGLTFLRKIMTQHPLPVVICSSVTEQGAEATFKAMEYGAVEVITKPRLGTKRFLEES
SIRICDAVKAAARARLHRLGHRTRDVAPKLTADAMLPGPTNFTRVQTTEKVVVVGASTGG
TEALQVFLEAMPPDAPPIAIVQHMPEHFTGAFSRRLDGICRIRVREAEDGDIMARGQALI
APGSSHMLLKRNGSRYTVEVKDGPLVRRHRPSVDVLFRSAARYAGANAVAAILTGMGDDG
AAGMKELHDMGAHTIAQDEATCIVFGMPHEAIRLGGVDRVLPLDAIAPAVLKACAGS
Download sequence
Identical sequences A0A0E0T344 A0A0H3A8X1 P62636
gi|120602582|ref|YP_966982.1| gi|46580007|ref|YP_010815.1| 391774.Dvul_1538 882.DVU1596 gi|387153551|ref|YP_005702487.1| WP_010938887.1.14085 WP_010938887.1.63145 YP_010815.1.77684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]