SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0TFP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0TFP3
Domain Number 1 Region: 31-119
Classification Level Classification E-value
Superfamily FlaG-like 6.8e-28
Family FlaG-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0TFP3
Sequence length 119
Comment (tr|A0A0E0TFP3|A0A0E0TFP3_GEOS2) Flagellar protein FlaG protein {ECO:0000313|EMBL:ADU95584.1} KW=Complete proteome OX=550542 OS=Geobacillus sp. (strain Y412MC52). GN=GYMC52_3231 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MTIERVSSSFLSYEPMRSEQAKGDVELSAARPQEAEASSPLERLPSEETLEKVVNGLNEL
VQPSHTSVRFELHKELNEYYVQVIDEKTHEVIREIPPKKLLDMYAAMMEFVGLLVDKKI
Download sequence
Identical sequences A0A0E0TFP3 A0A0K2H7M5
WP_013524627.1.50933 WP_013524627.1.59104 WP_013524627.1.80994 gi|261420557|ref|YP_003254239.1| APC35814 gi|319768226|ref|YP_004133727.1| 544556.GYMC61_3202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]