SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0UVE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E0UVE8
Domain Number - Region: 28-66
Classification Level Classification E-value
Superfamily Apolipoprotein A-II 0.034
Family Apolipoprotein A-II 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0UVE8
Sequence length 131
Comment (tr|A0A0E0UVE8|A0A0E0UVE8_LISMM) Uncharacterized protein {ECO:0000313|EMBL:AEH91945.1} KW=Complete proteome OX=1030009 OS=Listeria monocytogenes serotype 4a (strain M7). GN=LMM7_0940 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MAEKTIVEKLQLTKYKEAVILNQPDGADYFQNLANYEEKLADKQYDLIFDFVETLEELIT
FVKKLLLKINLLRMVIYFSPILKKAIKSSLHMYTAMNSCQRLKPMKKVTSTVAHSNSREW
SRSMKRTRLLA
Download sequence
Identical sequences A0A0E0UVE8
552536.LMHCC_1719 gi|217964996|ref|YP_002350674.1| gi|386026227|ref|YP_005947003.1| gi|386007634|ref|YP_005925912.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]