SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E1B0E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1B0E9
Domain Number 1 Region: 182-367
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.32e-64
Family Methylesterase CheB, C-terminal domain 0.00000939
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily CheY-like 3.27e-28
Family CheY-related 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1B0E9
Sequence length 368
Comment (tr|A0A0E1B0E9|A0A0E1B0E9_PSEAI) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1415629 OS=Pseudomonas aeruginosa MTB-1. GN=U769_18465 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MAVKVLVVDDSGFFRRRVSEILSADGQIQVVGTATNGREAIEQALALRPDVITMDYEMPL
MDGITAVRNIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVRQ
LLCEKVLTIARSNRRSISLPPLPSATSSSHAPASSSSLGASARASAGASPAPASTSAAPK
RKAYRLVAIGTSTGGPVALQRVLTQLPANFPAPLVLIQHMPAAFTKAFAERLDKLCRISV
KEAEDGDILRPGLALLAPGGKQMMVDGRGTVRILPGDERLNYKPCVDVTFGSAAKAYNDK
VLAVVLTGMGADGREGARLLKQGGSQVWAQDEASCVIYGMPMAVVKANLADAVYGLDDIG
RHLVEACQ
Download sequence
Identical sequences A0A022P588 A0A077JY15 A0A0E1B0E9 A0A0H2Z912 A0A0H3QVH0 A0A157WH69 A0A1C7BFM2 V6AI50
208963.PA14_45580 gi|564953572|ref|YP_008886142.1| WP_003087115.1.100278 WP_003087115.1.100456 WP_003087115.1.100469 WP_003087115.1.100473 WP_003087115.1.100476 WP_003087115.1.101269 WP_003087115.1.101590 WP_003087115.1.10174 WP_003087115.1.101781 WP_003087115.1.10248 WP_003087115.1.10257 WP_003087115.1.10271 WP_003087115.1.10435 WP_003087115.1.10575 WP_003087115.1.10764 WP_003087115.1.10895 WP_003087115.1.11130 WP_003087115.1.11318 WP_003087115.1.11417 WP_003087115.1.1183 WP_003087115.1.12081 WP_003087115.1.12150 WP_003087115.1.12200 WP_003087115.1.12400 WP_003087115.1.12660 WP_003087115.1.12890 WP_003087115.1.12922 WP_003087115.1.12930 WP_003087115.1.13041 WP_003087115.1.13077 WP_003087115.1.13085 WP_003087115.1.13208 WP_003087115.1.13266 WP_003087115.1.13270 WP_003087115.1.13364 WP_003087115.1.13533 WP_003087115.1.13642 WP_003087115.1.13718 WP_003087115.1.13743 WP_003087115.1.13795 WP_003087115.1.14116 WP_003087115.1.14251 WP_003087115.1.14378 WP_003087115.1.14476 WP_003087115.1.14525 WP_003087115.1.14564 WP_003087115.1.14615 WP_003087115.1.14679 WP_003087115.1.14690 WP_003087115.1.14754 WP_003087115.1.14815 WP_003087115.1.14839 WP_003087115.1.14981 WP_003087115.1.1516 WP_003087115.1.15231 WP_003087115.1.15328 WP_003087115.1.15373 WP_003087115.1.15408 WP_003087115.1.15606 WP_003087115.1.15666 WP_003087115.1.15886 WP_003087115.1.16694 WP_003087115.1.16751 WP_003087115.1.16811 WP_003087115.1.1704 WP_003087115.1.17108 WP_003087115.1.17155 WP_003087115.1.17177 WP_003087115.1.17189 WP_003087115.1.172 WP_003087115.1.17223 WP_003087115.1.17499 WP_003087115.1.1758 WP_003087115.1.1761 WP_003087115.1.18054 WP_003087115.1.18156 WP_003087115.1.18157 WP_003087115.1.18349 WP_003087115.1.18440 WP_003087115.1.18508 WP_003087115.1.18732 WP_003087115.1.18735 WP_003087115.1.18795 WP_003087115.1.18907 WP_003087115.1.19089 WP_003087115.1.19199 WP_003087115.1.19346 WP_003087115.1.19351 WP_003087115.1.19640 WP_003087115.1.19718 WP_003087115.1.19824 WP_003087115.1.19930 WP_003087115.1.2012 WP_003087115.1.20125 WP_003087115.1.20154 WP_003087115.1.20590 WP_003087115.1.20682 WP_003087115.1.20692 WP_003087115.1.20825 WP_003087115.1.20880 WP_003087115.1.20890 WP_003087115.1.21002 WP_003087115.1.21039 WP_003087115.1.21096 WP_003087115.1.21209 WP_003087115.1.21253 WP_003087115.1.21782 WP_003087115.1.21871 WP_003087115.1.21891 WP_003087115.1.221 WP_003087115.1.22316 WP_003087115.1.2237 WP_003087115.1.22390 WP_003087115.1.22477 WP_003087115.1.22573 WP_003087115.1.23013 WP_003087115.1.23331 WP_003087115.1.2355 WP_003087115.1.2374 WP_003087115.1.23938 WP_003087115.1.24087 WP_003087115.1.24183 WP_003087115.1.24319 WP_003087115.1.24382 WP_003087115.1.24413 WP_003087115.1.2453 WP_003087115.1.24851 WP_003087115.1.24938 WP_003087115.1.24940 WP_003087115.1.2511 WP_003087115.1.25191 WP_003087115.1.2529 WP_003087115.1.2530 WP_003087115.1.25477 WP_003087115.1.25641 WP_003087115.1.25675 WP_003087115.1.26010 WP_003087115.1.26025 WP_003087115.1.26301 WP_003087115.1.26473 WP_003087115.1.26553 WP_003087115.1.26816 WP_003087115.1.26862 WP_003087115.1.27028 WP_003087115.1.27039 WP_003087115.1.27073 WP_003087115.1.27211 WP_003087115.1.27259 WP_003087115.1.27288 WP_003087115.1.27549 WP_003087115.1.27772 WP_003087115.1.27933 WP_003087115.1.28057 WP_003087115.1.28078 WP_003087115.1.28193 WP_003087115.1.28505 WP_003087115.1.28699 WP_003087115.1.28713 WP_003087115.1.28757 WP_003087115.1.28878 WP_003087115.1.29003 WP_003087115.1.29008 WP_003087115.1.29070 WP_003087115.1.29127 WP_003087115.1.29137 WP_003087115.1.29440 WP_003087115.1.29633 WP_003087115.1.29650 WP_003087115.1.29973 WP_003087115.1.30020 WP_003087115.1.3030 WP_003087115.1.30475 WP_003087115.1.30563 WP_003087115.1.30615 WP_003087115.1.30693 WP_003087115.1.30842 WP_003087115.1.30943 WP_003087115.1.30973 WP_003087115.1.31457 WP_003087115.1.31563 WP_003087115.1.31587 WP_003087115.1.31633 WP_003087115.1.31655 WP_003087115.1.3172 WP_003087115.1.31732 WP_003087115.1.31751 WP_003087115.1.32134 WP_003087115.1.32235 WP_003087115.1.32359 WP_003087115.1.32626 WP_003087115.1.32821 WP_003087115.1.32879 WP_003087115.1.32998 WP_003087115.1.33009 WP_003087115.1.33047 WP_003087115.1.33097 WP_003087115.1.33294 WP_003087115.1.33340 WP_003087115.1.33438 WP_003087115.1.33441 WP_003087115.1.3351 WP_003087115.1.33521 WP_003087115.1.33547 WP_003087115.1.3368 WP_003087115.1.33728 WP_003087115.1.33814 WP_003087115.1.33833 WP_003087115.1.3385 WP_003087115.1.33945 WP_003087115.1.34143 WP_003087115.1.34150 WP_003087115.1.34203 WP_003087115.1.3436 WP_003087115.1.34401 WP_003087115.1.34461 WP_003087115.1.34465 WP_003087115.1.34556 WP_003087115.1.34583 WP_003087115.1.34878 WP_003087115.1.35104 WP_003087115.1.35149 WP_003087115.1.35442 WP_003087115.1.35529 WP_003087115.1.3555 WP_003087115.1.35762 WP_003087115.1.35968 WP_003087115.1.36064 WP_003087115.1.36266 WP_003087115.1.36267 WP_003087115.1.36285 WP_003087115.1.36378 WP_003087115.1.36435 WP_003087115.1.36608 WP_003087115.1.36708 WP_003087115.1.3672 WP_003087115.1.36756 WP_003087115.1.37050 WP_003087115.1.373 WP_003087115.1.37416 WP_003087115.1.3742 WP_003087115.1.37571 WP_003087115.1.37698 WP_003087115.1.37703 WP_003087115.1.3773 WP_003087115.1.37818 WP_003087115.1.38023 WP_003087115.1.3818 WP_003087115.1.38319 WP_003087115.1.38335 WP_003087115.1.38510 WP_003087115.1.38582 WP_003087115.1.38587 WP_003087115.1.38816 WP_003087115.1.3887 WP_003087115.1.38932 WP_003087115.1.39537 WP_003087115.1.39704 WP_003087115.1.39765 WP_003087115.1.39920 WP_003087115.1.40115 WP_003087115.1.40237 WP_003087115.1.40271 WP_003087115.1.40442 WP_003087115.1.40546 WP_003087115.1.40984 WP_003087115.1.40993 WP_003087115.1.41110 WP_003087115.1.41137 WP_003087115.1.41199 WP_003087115.1.41290 WP_003087115.1.41384 WP_003087115.1.41429 WP_003087115.1.41703 WP_003087115.1.4196 WP_003087115.1.42 WP_003087115.1.42047 WP_003087115.1.42316 WP_003087115.1.42381 WP_003087115.1.42411 WP_003087115.1.42499 WP_003087115.1.42508 WP_003087115.1.42690 WP_003087115.1.42723 WP_003087115.1.4273 WP_003087115.1.42854 WP_003087115.1.42870 WP_003087115.1.43022 WP_003087115.1.43026 WP_003087115.1.43212 WP_003087115.1.43245 WP_003087115.1.43286 WP_003087115.1.43326 WP_003087115.1.43356 WP_003087115.1.43593 WP_003087115.1.43696 WP_003087115.1.43756 WP_003087115.1.43783 WP_003087115.1.4397 WP_003087115.1.43998 WP_003087115.1.44269 WP_003087115.1.44486 WP_003087115.1.44552 WP_003087115.1.44565 WP_003087115.1.44725 WP_003087115.1.44804 WP_003087115.1.44870 WP_003087115.1.45199 WP_003087115.1.45298 WP_003087115.1.45306 WP_003087115.1.45353 WP_003087115.1.45358 WP_003087115.1.45604 WP_003087115.1.45611 WP_003087115.1.45635 WP_003087115.1.45636 WP_003087115.1.45678 WP_003087115.1.45700 WP_003087115.1.45920 WP_003087115.1.45946 WP_003087115.1.46093 WP_003087115.1.46306 WP_003087115.1.4640 WP_003087115.1.46633 WP_003087115.1.46866 WP_003087115.1.46935 WP_003087115.1.47314 WP_003087115.1.47374 WP_003087115.1.47469 WP_003087115.1.47551 WP_003087115.1.47930 WP_003087115.1.48094 WP_003087115.1.48141 WP_003087115.1.48382 WP_003087115.1.48472 WP_003087115.1.48487 WP_003087115.1.48579 WP_003087115.1.48810 WP_003087115.1.48840 WP_003087115.1.48851 WP_003087115.1.49108 WP_003087115.1.49184 WP_003087115.1.49244 WP_003087115.1.49293 WP_003087115.1.49566 WP_003087115.1.49806 WP_003087115.1.49922 WP_003087115.1.49948 WP_003087115.1.49988 WP_003087115.1.50232 WP_003087115.1.50450 WP_003087115.1.50459 WP_003087115.1.50783 WP_003087115.1.50922 WP_003087115.1.51173 WP_003087115.1.51472 WP_003087115.1.51733 WP_003087115.1.51917 WP_003087115.1.51928 WP_003087115.1.51943 WP_003087115.1.51957 WP_003087115.1.52212 WP_003087115.1.52355 WP_003087115.1.52372 WP_003087115.1.52403 WP_003087115.1.52409 WP_003087115.1.52500 WP_003087115.1.52591 WP_003087115.1.52728 WP_003087115.1.52790 WP_003087115.1.52850 WP_003087115.1.5289 WP_003087115.1.52939 WP_003087115.1.53038 WP_003087115.1.53287 WP_003087115.1.53414 WP_003087115.1.53528 WP_003087115.1.53586 WP_003087115.1.53663 WP_003087115.1.53678 WP_003087115.1.53946 WP_003087115.1.53951 WP_003087115.1.54003 WP_003087115.1.54076 WP_003087115.1.5420 WP_003087115.1.54354 WP_003087115.1.55 WP_003087115.1.55387 WP_003087115.1.55400 WP_003087115.1.55445 WP_003087115.1.55813 WP_003087115.1.56187 WP_003087115.1.56196 WP_003087115.1.56442 WP_003087115.1.56465 WP_003087115.1.56626 WP_003087115.1.56864 WP_003087115.1.56896 WP_003087115.1.57020 WP_003087115.1.57065 WP_003087115.1.57339 WP_003087115.1.57369 WP_003087115.1.57417 WP_003087115.1.57477 WP_003087115.1.57532 WP_003087115.1.57728 WP_003087115.1.57792 WP_003087115.1.57841 WP_003087115.1.57966 WP_003087115.1.58056 WP_003087115.1.58200 WP_003087115.1.58360 WP_003087115.1.58417 WP_003087115.1.5850 WP_003087115.1.58510 WP_003087115.1.5856 WP_003087115.1.58581 WP_003087115.1.5869 WP_003087115.1.58800 WP_003087115.1.58944 WP_003087115.1.5897 WP_003087115.1.59212 WP_003087115.1.59250 WP_003087115.1.59339 WP_003087115.1.59376 WP_003087115.1.59385 WP_003087115.1.59724 WP_003087115.1.59943 WP_003087115.1.60079 WP_003087115.1.60084 WP_003087115.1.60085 WP_003087115.1.60347 WP_003087115.1.60364 WP_003087115.1.60396 WP_003087115.1.60472 WP_003087115.1.60679 WP_003087115.1.60910 WP_003087115.1.60970 WP_003087115.1.61222 WP_003087115.1.61269 WP_003087115.1.61288 WP_003087115.1.61294 WP_003087115.1.61431 WP_003087115.1.61589 WP_003087115.1.616 WP_003087115.1.62010 WP_003087115.1.626 WP_003087115.1.62604 WP_003087115.1.62703 WP_003087115.1.62708 WP_003087115.1.62961 WP_003087115.1.62977 WP_003087115.1.63401 WP_003087115.1.63634 WP_003087115.1.63659 WP_003087115.1.63739 WP_003087115.1.63784 WP_003087115.1.63929 WP_003087115.1.63941 WP_003087115.1.64139 WP_003087115.1.64212 WP_003087115.1.64340 WP_003087115.1.6450 WP_003087115.1.64544 WP_003087115.1.64603 WP_003087115.1.64605 WP_003087115.1.6461 WP_003087115.1.64611 WP_003087115.1.64886 WP_003087115.1.65247 WP_003087115.1.65304 WP_003087115.1.65312 WP_003087115.1.65457 WP_003087115.1.65478 WP_003087115.1.65632 WP_003087115.1.65679 WP_003087115.1.65779 WP_003087115.1.65867 WP_003087115.1.66088 WP_003087115.1.66155 WP_003087115.1.6627 WP_003087115.1.66277 WP_003087115.1.66563 WP_003087115.1.66693 WP_003087115.1.66982 WP_003087115.1.67124 WP_003087115.1.67192 WP_003087115.1.67506 WP_003087115.1.67545 WP_003087115.1.6768 WP_003087115.1.67874 WP_003087115.1.67899 WP_003087115.1.67937 WP_003087115.1.6796 WP_003087115.1.68000 WP_003087115.1.68172 WP_003087115.1.68194 WP_003087115.1.68446 WP_003087115.1.68448 WP_003087115.1.68499 WP_003087115.1.68790 WP_003087115.1.68979 WP_003087115.1.69088 WP_003087115.1.6911 WP_003087115.1.69209 WP_003087115.1.69411 WP_003087115.1.69556 WP_003087115.1.70098 WP_003087115.1.70138 WP_003087115.1.70331 WP_003087115.1.70537 WP_003087115.1.70650 WP_003087115.1.70670 WP_003087115.1.70677 WP_003087115.1.71203 WP_003087115.1.71234 WP_003087115.1.71249 WP_003087115.1.71254 WP_003087115.1.71290 WP_003087115.1.71385 WP_003087115.1.71412 WP_003087115.1.71610 WP_003087115.1.7163 WP_003087115.1.71738 WP_003087115.1.71799 WP_003087115.1.71862 WP_003087115.1.71866 WP_003087115.1.72183 WP_003087115.1.7219 WP_003087115.1.72477 WP_003087115.1.72562 WP_003087115.1.72570 WP_003087115.1.72662 WP_003087115.1.72727 WP_003087115.1.72782 WP_003087115.1.72845 WP_003087115.1.72920 WP_003087115.1.73035 WP_003087115.1.73172 WP_003087115.1.73192 WP_003087115.1.73541 WP_003087115.1.73651 WP_003087115.1.73719 WP_003087115.1.7377 WP_003087115.1.74072 WP_003087115.1.74281 WP_003087115.1.74287 WP_003087115.1.74326 WP_003087115.1.7448 WP_003087115.1.7456 WP_003087115.1.74604 WP_003087115.1.74637 WP_003087115.1.74685 WP_003087115.1.74776 WP_003087115.1.74878 WP_003087115.1.74941 WP_003087115.1.7501 WP_003087115.1.75389 WP_003087115.1.75431 WP_003087115.1.75580 WP_003087115.1.75603 WP_003087115.1.7568 WP_003087115.1.75756 WP_003087115.1.76077 WP_003087115.1.76141 WP_003087115.1.76145 WP_003087115.1.76192 WP_003087115.1.76322 WP_003087115.1.76383 WP_003087115.1.76441 WP_003087115.1.76633 WP_003087115.1.76775 WP_003087115.1.76791 WP_003087115.1.76861 WP_003087115.1.77442 WP_003087115.1.78104 WP_003087115.1.78112 WP_003087115.1.78118 WP_003087115.1.78134 WP_003087115.1.78148 WP_003087115.1.78158 WP_003087115.1.78288 WP_003087115.1.7840 WP_003087115.1.78425 WP_003087115.1.78599 WP_003087115.1.78623 WP_003087115.1.78947 WP_003087115.1.78986 WP_003087115.1.7899 WP_003087115.1.79003 WP_003087115.1.79060 WP_003087115.1.79256 WP_003087115.1.79286 WP_003087115.1.79421 WP_003087115.1.79754 WP_003087115.1.79883 WP_003087115.1.79902 WP_003087115.1.79908 WP_003087115.1.8 WP_003087115.1.8013 WP_003087115.1.80258 WP_003087115.1.8028 WP_003087115.1.8038 WP_003087115.1.80454 WP_003087115.1.80683 WP_003087115.1.80715 WP_003087115.1.80785 WP_003087115.1.80880 WP_003087115.1.80892 WP_003087115.1.80910 WP_003087115.1.80926 WP_003087115.1.81338 WP_003087115.1.81349 WP_003087115.1.81368 WP_003087115.1.81380 WP_003087115.1.8141 WP_003087115.1.81426 WP_003087115.1.81470 WP_003087115.1.81643 WP_003087115.1.81708 WP_003087115.1.81784 WP_003087115.1.81856 WP_003087115.1.81874 WP_003087115.1.81927 WP_003087115.1.81957 WP_003087115.1.82260 WP_003087115.1.8238 WP_003087115.1.82606 WP_003087115.1.82686 WP_003087115.1.82798 WP_003087115.1.82810 WP_003087115.1.8284 WP_003087115.1.82882 WP_003087115.1.83267 WP_003087115.1.83317 WP_003087115.1.83374 WP_003087115.1.83440 WP_003087115.1.83460 WP_003087115.1.83503 WP_003087115.1.8351 WP_003087115.1.83534 WP_003087115.1.83540 WP_003087115.1.83698 WP_003087115.1.83871 WP_003087115.1.83937 WP_003087115.1.84138 WP_003087115.1.84174 WP_003087115.1.84178 WP_003087115.1.84526 WP_003087115.1.84558 WP_003087115.1.84684 WP_003087115.1.84825 WP_003087115.1.84865 WP_003087115.1.84937 WP_003087115.1.8498 WP_003087115.1.85059 WP_003087115.1.85150 WP_003087115.1.85303 WP_003087115.1.85311 WP_003087115.1.85574 WP_003087115.1.85633 WP_003087115.1.85638 WP_003087115.1.85920 WP_003087115.1.85978 WP_003087115.1.86047 WP_003087115.1.86182 WP_003087115.1.86243 WP_003087115.1.86432 WP_003087115.1.865 WP_003087115.1.86506 WP_003087115.1.86554 WP_003087115.1.86595 WP_003087115.1.86665 WP_003087115.1.867 WP_003087115.1.86796 WP_003087115.1.86822 WP_003087115.1.86970 WP_003087115.1.87104 WP_003087115.1.87182 WP_003087115.1.87316 WP_003087115.1.87463 WP_003087115.1.8749 WP_003087115.1.87547 WP_003087115.1.8777 WP_003087115.1.8785 WP_003087115.1.87877 WP_003087115.1.87888 WP_003087115.1.87970 WP_003087115.1.87975 WP_003087115.1.87981 WP_003087115.1.88415 WP_003087115.1.88540 WP_003087115.1.88750 WP_003087115.1.889 WP_003087115.1.88900 WP_003087115.1.89245 WP_003087115.1.89330 WP_003087115.1.89434 WP_003087115.1.89440 WP_003087115.1.89480 WP_003087115.1.89523 WP_003087115.1.89669 WP_003087115.1.89871 WP_003087115.1.89992 WP_003087115.1.90272 WP_003087115.1.91012 WP_003087115.1.91093 WP_003087115.1.91236 WP_003087115.1.91281 WP_003087115.1.91360 WP_003087115.1.91392 WP_003087115.1.91416 WP_003087115.1.91467 WP_003087115.1.91527 WP_003087115.1.91585 WP_003087115.1.91796 WP_003087115.1.91882 WP_003087115.1.92043 WP_003087115.1.9219 WP_003087115.1.92589 WP_003087115.1.92594 WP_003087115.1.92630 WP_003087115.1.9272 WP_003087115.1.92759 WP_003087115.1.92839 WP_003087115.1.93122 WP_003087115.1.93196 WP_003087115.1.93446 WP_003087115.1.9349 WP_003087115.1.93520 WP_003087115.1.93568 WP_003087115.1.93889 WP_003087115.1.94065 WP_003087115.1.94078 WP_003087115.1.94218 WP_003087115.1.94230 WP_003087115.1.94288 WP_003087115.1.94333 WP_003087115.1.9444 WP_003087115.1.94732 WP_003087115.1.94742 WP_003087115.1.94943 WP_003087115.1.95018 WP_003087115.1.95354 WP_003087115.1.95782 WP_003087115.1.96008 WP_003087115.1.96058 WP_003087115.1.961 WP_003087115.1.96863 WP_003087115.1.97204 WP_003087115.1.97377 WP_003087115.1.97461 WP_003087115.1.97488 WP_003087115.1.97499 WP_003087115.1.97503 WP_003087115.1.97521 WP_003087115.1.97583 WP_003087115.1.97784 WP_003087115.1.98111 WP_003087115.1.985 WP_003087115.1.98693 WP_003087115.1.98718 WP_003087115.1.98873 WP_003087115.1.98963 WP_003087115.1.99065 WP_003087115.1.99378 WP_003087115.1.99647 WP_003087115.1.99772 WP_003087115.1.99835 WP_003087115.1.99930 gi|386065283|ref|YP_005980587.1| gi|116049404|ref|YP_791793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]