SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E1BWF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1BWF5
Domain Number 1 Region: 194-381
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.24e-60
Family Methylesterase CheB, C-terminal domain 0.00000761
Further Details:      
 
Domain Number 2 Region: 4-107
Classification Level Classification E-value
Superfamily CheY-like 0.000000000000465
Family CheY-related 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E1BWF5
Sequence length 385
Comment (tr|A0A0E1BWF5|A0A0E1BWF5_BORHE) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=1313291 OS=Borrelia hermsii MTW. GN=BHW_0073900 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borrelia.
Sequence
MQKKIYVLVIEASSVNRKVISDIINSSLKLEVIATAANTDFALKKLKKHPDVILLSLETE
TIQEIAFIKKKQNINNKIPVIILSSNKDIAKNAILKGADDFIIKTNDKLESIKDKIIDLL
SIYGNKTIKNKIITNINFTFKTNNPLINGSIKEDNSNTTEATDNNLIITKNKNETNNLNE
EIIDEKALKKLKNRKFEIVVIGISTGGPAALKEILPEIPKNFPVPIIIVQHMPKGFTAEF
ARNLNNICNLAVKETSNKEILQKGFIYISSGGYHTRINKINENYQIEVFDGANVNGHKPS
IGVLFKSISENVKEKAIALIMTGMGSDGSREIGGIKKAGGLTIAQDEQSSVVFGMPKIAI
EENNVDYIVSISHVVKLLKAILLDG
Download sequence
Identical sequences A0A0E1BWF5
WP_025399741.1.87898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]