SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E1E0N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1E0N5
Domain Number - Region: 20-61
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0288
Family Capz beta-1 subunit 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E1E0N5
Sequence length 283
Comment (tr|A0A0E1E0N5|A0A0E1E0N5_STRSZ) Uncharacterized protein {ECO:0000313|EMBL:AIA68709.1} KW=Complete proteome OX=1403449 OS=Streptococcus equi subsp. zooepidemicus CY. GN=Q426_04160 OC=Streptococcus.
Sequence
MSGVFIIDDNKVSIKKLETDNSTVISINGILSVDTEKYKANSVNFDGSYKPDEDESLKIE
NFDLPDEIKEAINNPLGVEKLIATDNDLNIRAVFLTLDDGEEGRIVFQRTQKRQLLLGGR
ITLFWNKDTFISTKKPGVVITDSIDAYYENGTLYFKSYYLANQILNLNKYYRQATDEDIR
TFCQSSCFYVNDLDSLVSASNNWTRKKIAYILDTKVLETNSIDFILQDAKELGLQFQTNG
ENKIVFPEDLKAQKELLSYLADEIYKGRLTDDVYLTNSKRTLK
Download sequence
Identical sequences A0A0E1E0N5
gi|414564013|ref|YP_006042974.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]