SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E1JGR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1JGR8
Domain Number 1 Region: 154-341
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.14e-71
Family Methylesterase CheB, C-terminal domain 0.000000272
Further Details:      
 
Domain Number 2 Region: 1-109
Classification Level Classification E-value
Superfamily CheY-like 3.7e-27
Family CheY-related 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E1JGR8
Sequence length 353
Comment (tr|A0A0E1JGR8|A0A0E1JGR8_9ENTR) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=299766 OS=Enterobacter hormaechei subsp. steigerwaltii. GN=LI62_18715 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MKRIRVLTVDDSALMRNILSAVINQQPDMEMVGTAPDPLIAREMIKQLNPDVLTLDIDMP
KMDGLEFLSRLMRLRPMPVVMISSMTTRGSKATMAALEHGAVDFLAKPDQRIAGNLELWG
VQVAEKIRIAAKAKLGRQAEVASPILRGITVDPQSIVAIGSSTGGTEALRQVLTPLPASV
PGIVIAQHMPAGFTRSFAQRLDSLCQIKVHEADDGEPVLPGTALIAPGDKHMEIVRHGKG
YAVRLTDAPPVNRHRPSVDVLFNSVAQLVGAHASAAILTGMGADGARGLLALRESGAFTL
AQSEASCVVFGMPREAIALGAAREIVDLNKISQRLLESFSHKPRRSGENTHVG
Download sequence
Identical sequences A0A0E1JGR8 A0A181XD94 A0A1V3WA60 A0A222RHP7
WP_023295295.1.12067 WP_023295295.1.12196 WP_023295295.1.12290 WP_023295295.1.12513 WP_023295295.1.14059 WP_023295295.1.14856 WP_023295295.1.15748 WP_023295295.1.16030 WP_023295295.1.16149 WP_023295295.1.17510 WP_023295295.1.19570 WP_023295295.1.19966 WP_023295295.1.20555 WP_023295295.1.21439 WP_023295295.1.23892 WP_023295295.1.26530 WP_023295295.1.26874 WP_023295295.1.30604 WP_023295295.1.30839 WP_023295295.1.3210 WP_023295295.1.32901 WP_023295295.1.34582 WP_023295295.1.35292 WP_023295295.1.36012 WP_023295295.1.37315 WP_023295295.1.37620 WP_023295295.1.38255 WP_023295295.1.41788 WP_023295295.1.41953 WP_023295295.1.42124 WP_023295295.1.42527 WP_023295295.1.42968 WP_023295295.1.43187 WP_023295295.1.45338 WP_023295295.1.45786 WP_023295295.1.45800 WP_023295295.1.4609 WP_023295295.1.48574 WP_023295295.1.48760 WP_023295295.1.48920 WP_023295295.1.49618 WP_023295295.1.49797 WP_023295295.1.50494 WP_023295295.1.51695 WP_023295295.1.51853 WP_023295295.1.52580 WP_023295295.1.54197 WP_023295295.1.56618 WP_023295295.1.5717 WP_023295295.1.57605 WP_023295295.1.57748 WP_023295295.1.59408 WP_023295295.1.59448 WP_023295295.1.60892 WP_023295295.1.60951 WP_023295295.1.61545 WP_023295295.1.61855 WP_023295295.1.63 WP_023295295.1.65594 WP_023295295.1.68316 WP_023295295.1.68400 WP_023295295.1.69874 WP_023295295.1.74669 WP_023295295.1.76688 WP_023295295.1.78743 WP_023295295.1.78829 WP_023295295.1.79517 WP_023295295.1.80075 WP_023295295.1.80172 WP_023295295.1.80933 WP_023295295.1.81363 WP_023295295.1.83133 WP_023295295.1.83675 WP_023295295.1.85159 WP_023295295.1.8833 WP_023295295.1.90966 WP_023295295.1.92542 WP_023295295.1.94120 WP_023295295.1.94939 WP_023295295.1.9777 WP_023295295.1.97924 WP_023295295.1.9846 WP_023295295.1.98930 WP_023295295.1.99169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]