SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1KUW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1KUW8
Domain Number - Region: 34-87
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.00562
Family E6 C-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1KUW8
Sequence length 113
Comment (tr|A0A0E1KUW8|A0A0E1KUW8_CLOBO) Uncharacterized protein {ECO:0000313|EMBL:AJE11035.1} KW=Complete proteome OX=1408283 OS=Clostridium botulinum CDC_1436. GN=T259_909 OC=Clostridium.
Sequence
MSKHCKYCKKTIFKAFIKRPGIIDLKENEPKILKEIENKFAYQVVECLNCGKNLTNDDLV
GTVICKNCKKEIPEDSLIEGVCVDCYLAKNRPDLSNLPKEDLIKKILNLEKEI
Download sequence
Identical sequences A0A0E1KUW8 A0A2I4NZU2
WP_003361612.1.19327 WP_003361612.1.20373 WP_003361612.1.28306 WP_003361612.1.34328 WP_003361612.1.49727 WP_003361612.1.57916 WP_003361612.1.69463 WP_003361612.1.95863 WP_003361612.1.97020 515621.CLJ_B3459 gi|237796642|ref|YP_002864194.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]