SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E1RZU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1RZU5
Domain Number 1 Region: 340-539
Classification Level Classification E-value
Superfamily MIR domain 2.09e-58
Family MIR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1RZU5
Sequence length 954
Comment (tr|A0A0E1RZU5|A0A0E1RZU5_COCIM) Dolichyl-phosphate-mannose-protein mannosyltransferase {ECO:0000313|EMBL:EAS35084.2} KW=Complete proteome; Reference proteome OX=246410 OS=Coccidioides immitis (strain RS) (Valley fever fungus). GN=CIMG_00438 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MPSKSSKAGLEAKSPSRRSSRSPGRSPGPKNRRKAAAQVSDYTSEGVQDYDIFELPKSDY
KLMLCITALATIVRLFRIYQPSSVVFDEVHFGGFAMKYIKGKFFMDVHPPLAKLLITLAG
FLGGFRGDFDFKEIGKDYLEPGVPYVAMRMLPAVLGILSVPTMFFTLKASGCRTITASLG
ALLVTFENGLVTQSRFILLDSPLVFFTALTVLSFTSFTNQHEQGPSKAFGPAWWFWLTAT
GLFLGATLSVKWVGLFTVAWVGSLTVLQLWVLLGDTRTVTVDIWFKHFFARAFCLIIIPL
TMYLAMFAIHFLCLVNPGEGDGFMSSEFQATLNSKGMKDVPADVAFGSRVSIRHHNTQGG
YLHSHSHMYPTGSKQQQITLYPHKDENNIWIMENQTQPLGSYGQVQGPHAWDNLTAGFIE
NGATIKLYHVTTDRRLHSHDHRPPVTEADWQNEVSAYGYEGFPGDANDLFRVEIVNSLSK
GAEAKKRLRTIETKFKLVHVMSGCVLFSHPVKLPSWGFEQQEVTCAKGGSLPNSIWYVEH
NEHPMFGPDVEKVNYRRPGFFAKFWELQRVMWRTNAGLVESHAWDSRPTSWPLLLRGINF
WAKSHRQIYLIGNPLIWWASTASIVAYVIFKGLAVVRWQRGFGDYHNVNFKRFDYEIGQT
VLGWAFHYFPFYLMARQLFLHHYLPALYFAIIAFCQIFDFVANRLTLCGSKKNTIAGSVF
FVLFLAASIATFTLFSPLAYGNPWTQDACRKVKLLSSWDFDCNTFYTDLAQYSSIANVGS
SQPKATVTPPKAPAQEPAPQQQKQPQEPPQRNGQQEQQKEKEKEPAEKAEFTMPAGQRVI
NSEESVEYRDQDGNLLDPEQVASMAKAGNVSFKTRYETRTRVIDGQGREVKQNVAPPHPD
VEGQNPETVGKDNKNIPRDKPASVPGDEKSVPQEDQKPKPASEGKEATRNADEL
Download sequence
Identical sequences A0A0E1RZU5
CIMG_00438T0 XP_001246667.2.59393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]