SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1SEM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1SEM8
Domain Number 1 Region: 161-266
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 4.71e-19
Family NAD-binding domain of HMG-CoA reductase 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E1SEM8
Sequence length 282
Comment (tr|A0A0E1SEM8|A0A0E1SEM8_BURPE) Uncharacterized protein {ECO:0000313|EMBL:EBA49413.1} KW=Complete proteome OX=425067 OS=Burkholderia pseudomallei 305. GN=BURPS305_5198 OC=Burkholderiaceae; Burkholderia; pseudomallei group.
Sequence
MDHSTVFRAMLPTFDAGETRIAVAFPSFAERLPLVRLGRQGLVFRARGAMPPVCGLPRSA
TLYLDDEPLCTLRLVIREVERCDDGAHDLTMQPSAANGDALLWHALRTRCRHARAPLAPR
APDERPAPGTQASARRRDTAPRADAARPESGAPRAAGTGVRMTRSAAFRLADRGDALFFA
DWLEYHFDELRALAQGLSPRLHLNELERDLAGDEVDVRFVYDIDGHADRRMLTDCARQAC
DWIATEVRRRFDLPIAEQRFGARKPRRATRAIRFRRNNSGRT
Download sequence
Identical sequences A0A0E1SEM8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]