SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E1VJY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1VJY3
Domain Number 1 Region: 199-459
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.47e-71
Family Pyruvate oxidase and decarboxylase Pyr module 0.068
Further Details:      
 
Domain Number 2 Region: 4-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.75e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0055
Further Details:      
 
Domain Number 3 Region: 472-582
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.14e-23
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1VJY3
Sequence length 586
Comment (tr|A0A0E1VJY3|A0A0E1VJY3_STAA3) 2-oxoacid:acceptor oxidoreductase, alpha subunit {ECO:0000313|EMBL:EES93047.1} KW=Complete proteome OX=450394 OS=Staphylococcus aureus subsp. aureus USA300_TCH959. GN=HMPREF0776_2290 OC=Staphylococcus.
Sequence
MKPQLSWKVGGQQGEGIESTGEIFATAMNRKGYYLYGYRHFSSRIKGGHTNNKIRVSTTP
VHAISDDLDILIAFDQETIDVNHHEMREDSIILADAKAKPVKPEGCHAQLIELPFTATAK
ELGTALMKNMVAIGATSALMNLNTNTFEELITNMFSKKGDKVVEVNIQALNEGYQLMQSR
LPEIDGDFELESTDALPHLYMIGNDAIGLGAIAAGSQFMAAYPITPASEVMEYMIANISK
VNGAVIQTEDEIAAVTMAIGANYGGVRAFTASAGPGLSLMMEAIGLSGMTETPLVIINTQ
RGGPSTGLPTKQEQSDLMQMIYGTHGDIPKIVVAPTDAEDAFYLTMEAFNLAEQYQCPVI
VLSDLQLSLGKQTVEKLDYNRIEIKRGEIIQSDIEREEDDKGYFKRYALTSNGVSPRPIP
GVKGGIHHITGVEHNEEGKPSESASNRQQQMEKRMRKIEQLLIESPVEANLQHEDADILY
IGFISTKGAIQEGSNRLNQQGIKVNTIQIRQLHPFPTSVIQDAVNKAKKVVVVEHNYQGQ
LASIIKMNVNIHDKIENYTKYDGTPFLPHEIEEKGKIIATEIKEMV
Download sequence
Identical sequences A0A0E1VJY3 A0A0H3JPV6 A0A0H3JS40 A0A181EKG0
gi|148267779|ref|YP_001246722.1| gi|384864516|ref|YP_005749875.1| gi|150393838|ref|YP_001316513.1| 158878.SAV1289 158879.SA1131 359786.SaurJH9_1349 359787.SaurJH1_1375 418127.SAHV_1279 681288.SAAV_1264 gi|15926872|ref|NP_374405.1| gi|269202906|ref|YP_003282175.1| gi|404478630|ref|YP_006710060.1| gi|156979610|ref|YP_001441869.1| gi|387150432|ref|YP_005741996.1| gi|15924279|ref|NP_371813.1| gi|387602566|ref|YP_005734087.1| APC66913.0 WP_000804320.1.10006 WP_000804320.1.10014 WP_000804320.1.100171 WP_000804320.1.100184 WP_000804320.1.100235 WP_000804320.1.100265 WP_000804320.1.100272 WP_000804320.1.100310 WP_000804320.1.10032 WP_000804320.1.100347 WP_000804320.1.100399 WP_000804320.1.100452 WP_000804320.1.10046 WP_000804320.1.100464 WP_000804320.1.10050 WP_000804320.1.10053 WP_000804320.1.100534 WP_000804320.1.100535 WP_000804320.1.100562 WP_000804320.1.100582 WP_000804320.1.100596 WP_000804320.1.100678 WP_000804320.1.100693 WP_000804320.1.100699 WP_000804320.1.100704 WP_000804320.1.100719 WP_000804320.1.100726 WP_000804320.1.100823 WP_000804320.1.100832 WP_000804320.1.100860 WP_000804320.1.100888 WP_000804320.1.100922 WP_000804320.1.100934 WP_000804320.1.10097 WP_000804320.1.101002 WP_000804320.1.101019 WP_000804320.1.101027 WP_000804320.1.101055 WP_000804320.1.101058 WP_000804320.1.101068 WP_000804320.1.101071 WP_000804320.1.101072 WP_000804320.1.101103 WP_000804320.1.10111 WP_000804320.1.101142 WP_000804320.1.101160 WP_000804320.1.101192 WP_000804320.1.101217 WP_000804320.1.101262 WP_000804320.1.101329 WP_000804320.1.101352 WP_000804320.1.101379 WP_000804320.1.101414 WP_000804320.1.101440 WP_000804320.1.101441 WP_000804320.1.10148 WP_000804320.1.101495 WP_000804320.1.101531 WP_000804320.1.101567 WP_000804320.1.101617 WP_000804320.1.10165 WP_000804320.1.101661 WP_000804320.1.101670 WP_000804320.1.101691 WP_000804320.1.101704 WP_000804320.1.101728 WP_000804320.1.101813 WP_000804320.1.101820 WP_000804320.1.101821 WP_000804320.1.101825 WP_000804320.1.101852 WP_000804320.1.101902 WP_000804320.1.101906 WP_000804320.1.101943 WP_000804320.1.101999 WP_000804320.1.102065 WP_000804320.1.102084 WP_000804320.1.10209 WP_000804320.1.102096 WP_000804320.1.102123 WP_000804320.1.102126 WP_000804320.1.102130 WP_000804320.1.102132 WP_000804320.1.10238 WP_000804320.1.1025 WP_000804320.1.10274 WP_000804320.1.10301 WP_000804320.1.10308 WP_000804320.1.1031 WP_000804320.1.10343 WP_000804320.1.10358 WP_000804320.1.1043 WP_000804320.1.10436 WP_000804320.1.10469 WP_000804320.1.10481 WP_000804320.1.10526 WP_000804320.1.1060 WP_000804320.1.10617 WP_000804320.1.10624 WP_000804320.1.10749 WP_000804320.1.10751 WP_000804320.1.1077 WP_000804320.1.10785 WP_000804320.1.10823 WP_000804320.1.10843 WP_000804320.1.10858 WP_000804320.1.10919 WP_000804320.1.10942 WP_000804320.1.10976 WP_000804320.1.10979 WP_000804320.1.10985 WP_000804320.1.11001 WP_000804320.1.11069 WP_000804320.1.11073 WP_000804320.1.11083 WP_000804320.1.11084 WP_000804320.1.1115 WP_000804320.1.11162 WP_000804320.1.11188 WP_000804320.1.11220 WP_000804320.1.11223 WP_000804320.1.1124 WP_000804320.1.11261 WP_000804320.1.11281 WP_000804320.1.11282 WP_000804320.1.11286 WP_000804320.1.11322 WP_000804320.1.11333 WP_000804320.1.11378 WP_000804320.1.11403 WP_000804320.1.11447 WP_000804320.1.11451 WP_000804320.1.1147 WP_000804320.1.11475 WP_000804320.1.11504 WP_000804320.1.11513 WP_000804320.1.11556 WP_000804320.1.11611 WP_000804320.1.11640 WP_000804320.1.11646 WP_000804320.1.11660 WP_000804320.1.11663 WP_000804320.1.1171 WP_000804320.1.11730 WP_000804320.1.11736 WP_000804320.1.11741 WP_000804320.1.11768 WP_000804320.1.11781 WP_000804320.1.11794 WP_000804320.1.11837 WP_000804320.1.11884 WP_000804320.1.11903 WP_000804320.1.11919 WP_000804320.1.12019 WP_000804320.1.12042 WP_000804320.1.1210 WP_000804320.1.12137 WP_000804320.1.12149 WP_000804320.1.12152 WP_000804320.1.12170 WP_000804320.1.12175 WP_000804320.1.12234 WP_000804320.1.12256 WP_000804320.1.12330 WP_000804320.1.12361 WP_000804320.1.12366 WP_000804320.1.12391 WP_000804320.1.12436 WP_000804320.1.12437 WP_000804320.1.12508 WP_000804320.1.1257 WP_000804320.1.12598 WP_000804320.1.12605 WP_000804320.1.12608 WP_000804320.1.12618 WP_000804320.1.12685 WP_000804320.1.12705 WP_000804320.1.12707 WP_000804320.1.12733 WP_000804320.1.12737 WP_000804320.1.12770 WP_000804320.1.12780 WP_000804320.1.12788 WP_000804320.1.12802 WP_000804320.1.12829 WP_000804320.1.12858 WP_000804320.1.12884 WP_000804320.1.12904 WP_000804320.1.12918 WP_000804320.1.12920 WP_000804320.1.12951 WP_000804320.1.13062 WP_000804320.1.13112 WP_000804320.1.13154 WP_000804320.1.13169 WP_000804320.1.13170 WP_000804320.1.13189 WP_000804320.1.13243 WP_000804320.1.13250 WP_000804320.1.13326 WP_000804320.1.13355 WP_000804320.1.13366 WP_000804320.1.13376 WP_000804320.1.13379 WP_000804320.1.13405 WP_000804320.1.13448 WP_000804320.1.13514 WP_000804320.1.13554 WP_000804320.1.13612 WP_000804320.1.13665 WP_000804320.1.13668 WP_000804320.1.13670 WP_000804320.1.13728 WP_000804320.1.13769 WP_000804320.1.13870 WP_000804320.1.13879 WP_000804320.1.13884 WP_000804320.1.13897 WP_000804320.1.13933 WP_000804320.1.13948 WP_000804320.1.13986 WP_000804320.1.13987 WP_000804320.1.14025 WP_000804320.1.14097 WP_000804320.1.14143 WP_000804320.1.14163 WP_000804320.1.1418 WP_000804320.1.1420 WP_000804320.1.14201 WP_000804320.1.1425 WP_000804320.1.1429 WP_000804320.1.14298 WP_000804320.1.14305 WP_000804320.1.14337 WP_000804320.1.14342 WP_000804320.1.14349 WP_000804320.1.14358 WP_000804320.1.14363 WP_000804320.1.14397 WP_000804320.1.14412 WP_000804320.1.14535 WP_000804320.1.14577 WP_000804320.1.14596 WP_000804320.1.14639 WP_000804320.1.14665 WP_000804320.1.14681 WP_000804320.1.14696 WP_000804320.1.1471 WP_000804320.1.14734 WP_000804320.1.14747 WP_000804320.1.14770 WP_000804320.1.14774 WP_000804320.1.14825 WP_000804320.1.14846 WP_000804320.1.14874 WP_000804320.1.14967 WP_000804320.1.14970 WP_000804320.1.15015 WP_000804320.1.15029 WP_000804320.1.15071 WP_000804320.1.15098 WP_000804320.1.15108 WP_000804320.1.15150 WP_000804320.1.15173 WP_000804320.1.15185 WP_000804320.1.1520 WP_000804320.1.15201 WP_000804320.1.15206 WP_000804320.1.1525 WP_000804320.1.15268 WP_000804320.1.15269 WP_000804320.1.15294 WP_000804320.1.15296 WP_000804320.1.15389 WP_000804320.1.15403 WP_000804320.1.15421 WP_000804320.1.15532 WP_000804320.1.15533 WP_000804320.1.15544 WP_000804320.1.15546 WP_000804320.1.1558 WP_000804320.1.15590 WP_000804320.1.15591 WP_000804320.1.1564 WP_000804320.1.15679 WP_000804320.1.1569 WP_000804320.1.15691 WP_000804320.1.15722 WP_000804320.1.15785 WP_000804320.1.15812 WP_000804320.1.15819 WP_000804320.1.15888 WP_000804320.1.159 WP_000804320.1.15920 WP_000804320.1.15921 WP_000804320.1.15925 WP_000804320.1.15948 WP_000804320.1.16018 WP_000804320.1.16068 WP_000804320.1.16096 WP_000804320.1.16098 WP_000804320.1.16114 WP_000804320.1.16140 WP_000804320.1.16157 WP_000804320.1.16195 WP_000804320.1.16203 WP_000804320.1.16223 WP_000804320.1.1623 WP_000804320.1.16251 WP_000804320.1.16265 WP_000804320.1.16276 WP_000804320.1.16311 WP_000804320.1.16395 WP_000804320.1.16399 WP_000804320.1.16407 WP_000804320.1.16436 WP_000804320.1.16478 WP_000804320.1.16589 WP_000804320.1.16632 WP_000804320.1.16639 WP_000804320.1.1665 WP_000804320.1.16651 WP_000804320.1.16653 WP_000804320.1.16693 WP_000804320.1.16747 WP_000804320.1.16761 WP_000804320.1.16794 WP_000804320.1.16815 WP_000804320.1.16824 WP_000804320.1.16880 WP_000804320.1.16882 WP_000804320.1.16920 WP_000804320.1.16925 WP_000804320.1.16969 WP_000804320.1.170 WP_000804320.1.17009 WP_000804320.1.17012 WP_000804320.1.17046 WP_000804320.1.17080 WP_000804320.1.17122 WP_000804320.1.17132 WP_000804320.1.17139 WP_000804320.1.17143 WP_000804320.1.17157 WP_000804320.1.17176 WP_000804320.1.17180 WP_000804320.1.17201 WP_000804320.1.17240 WP_000804320.1.1729 WP_000804320.1.17309 WP_000804320.1.17327 WP_000804320.1.1736 WP_000804320.1.1740 WP_000804320.1.1741 WP_000804320.1.17419 WP_000804320.1.17454 WP_000804320.1.17529 WP_000804320.1.17531 WP_000804320.1.1756 WP_000804320.1.17569 WP_000804320.1.17590 WP_000804320.1.17643 WP_000804320.1.1765 WP_000804320.1.17671 WP_000804320.1.17717 WP_000804320.1.17718 WP_000804320.1.17725 WP_000804320.1.17737 WP_000804320.1.17796 WP_000804320.1.17818 WP_000804320.1.17832 WP_000804320.1.17847 WP_000804320.1.17853 WP_000804320.1.17909 WP_000804320.1.17922 WP_000804320.1.17928 WP_000804320.1.17943 WP_000804320.1.17974 WP_000804320.1.17987 WP_000804320.1.18011 WP_000804320.1.18043 WP_000804320.1.18069 WP_000804320.1.18080 WP_000804320.1.18113 WP_000804320.1.18140 WP_000804320.1.18153 WP_000804320.1.18203 WP_000804320.1.18237 WP_000804320.1.18248 WP_000804320.1.18261 WP_000804320.1.18288 WP_000804320.1.1829 WP_000804320.1.18301 WP_000804320.1.18309 WP_000804320.1.18310 WP_000804320.1.18360 WP_000804320.1.18412 WP_000804320.1.18429 WP_000804320.1.1847 WP_000804320.1.18487 WP_000804320.1.18495 WP_000804320.1.18506 WP_000804320.1.18507 WP_000804320.1.18539 WP_000804320.1.18560 WP_000804320.1.18570 WP_000804320.1.18591 WP_000804320.1.18632 WP_000804320.1.18656 WP_000804320.1.18679 WP_000804320.1.18719 WP_000804320.1.18741 WP_000804320.1.18777 WP_000804320.1.18792 WP_000804320.1.18818 WP_000804320.1.18819 WP_000804320.1.18834 WP_000804320.1.18882 WP_000804320.1.1892 WP_000804320.1.18963 WP_000804320.1.18965 WP_000804320.1.18974 WP_000804320.1.18996 WP_000804320.1.19014 WP_000804320.1.19052 WP_000804320.1.19082 WP_000804320.1.19102 WP_000804320.1.19109 WP_000804320.1.1911 WP_000804320.1.1921 WP_000804320.1.19301 WP_000804320.1.19306 WP_000804320.1.19322 WP_000804320.1.19375 WP_000804320.1.19377 WP_000804320.1.1943 WP_000804320.1.19430 WP_000804320.1.19450 WP_000804320.1.19537 WP_000804320.1.19555 WP_000804320.1.19577 WP_000804320.1.19611 WP_000804320.1.1962 WP_000804320.1.1964 WP_000804320.1.19643 WP_000804320.1.19700 WP_000804320.1.19701 WP_000804320.1.19725 WP_000804320.1.19732 WP_000804320.1.1974 WP_000804320.1.19748 WP_000804320.1.19759 WP_000804320.1.19792 WP_000804320.1.19816 WP_000804320.1.19848 WP_000804320.1.19881 WP_000804320.1.19891 WP_000804320.1.19912 WP_000804320.1.19921 WP_000804320.1.19980 WP_000804320.1.19981 WP_000804320.1.19982 WP_000804320.1.20049 WP_000804320.1.20052 WP_000804320.1.2007 WP_000804320.1.20078 WP_000804320.1.20090 WP_000804320.1.20100 WP_000804320.1.20156 WP_000804320.1.20161 WP_000804320.1.20167 WP_000804320.1.20191 WP_000804320.1.20214 WP_000804320.1.20245 WP_000804320.1.2029 WP_000804320.1.20324 WP_000804320.1.20340 WP_000804320.1.20394 WP_000804320.1.20398 WP_000804320.1.20399 WP_000804320.1.20411 WP_000804320.1.20447 WP_000804320.1.20479 WP_000804320.1.20487 WP_000804320.1.20558 WP_000804320.1.20574 WP_000804320.1.20579 WP_000804320.1.20585 WP_000804320.1.20611 WP_000804320.1.20619 WP_000804320.1.20620 WP_000804320.1.20736 WP_000804320.1.20796 WP_000804320.1.20821 WP_000804320.1.20846 WP_000804320.1.20867 WP_000804320.1.20878 WP_000804320.1.20913 WP_000804320.1.20922 WP_000804320.1.20935 WP_000804320.1.20939 WP_000804320.1.20945 WP_000804320.1.20971 WP_000804320.1.20979 WP_000804320.1.21009 WP_000804320.1.21056 WP_000804320.1.21064 WP_000804320.1.21066 WP_000804320.1.21078 WP_000804320.1.21102 WP_000804320.1.21109 WP_000804320.1.21111 WP_000804320.1.21154 WP_000804320.1.21183 WP_000804320.1.2119 WP_000804320.1.21257 WP_000804320.1.21272 WP_000804320.1.21313 WP_000804320.1.21330 WP_000804320.1.21339 WP_000804320.1.2135 WP_000804320.1.21359 WP_000804320.1.21375 WP_000804320.1.21379 WP_000804320.1.21393 WP_000804320.1.21449 WP_000804320.1.21464 WP_000804320.1.21480 WP_000804320.1.21500 WP_000804320.1.21511 WP_000804320.1.21514 WP_000804320.1.21572 WP_000804320.1.2159 WP_000804320.1.2160 WP_000804320.1.21636 WP_000804320.1.21724 WP_000804320.1.21746 WP_000804320.1.21763 WP_000804320.1.2178 WP_000804320.1.21787 WP_000804320.1.21828 WP_000804320.1.21830 WP_000804320.1.21894 WP_000804320.1.21954 WP_000804320.1.21988 WP_000804320.1.22022 WP_000804320.1.22027 WP_000804320.1.22065 WP_000804320.1.22082 WP_000804320.1.22093 WP_000804320.1.2211 WP_000804320.1.22111 WP_000804320.1.22177 WP_000804320.1.22197 WP_000804320.1.22200 WP_000804320.1.22227 WP_000804320.1.22259 WP_000804320.1.22302 WP_000804320.1.22369 WP_000804320.1.22400 WP_000804320.1.22418 WP_000804320.1.22493 WP_000804320.1.22531 WP_000804320.1.22533 WP_000804320.1.22559 WP_000804320.1.22650 WP_000804320.1.22696 WP_000804320.1.22702 WP_000804320.1.22727 WP_000804320.1.22738 WP_000804320.1.22739 WP_000804320.1.22789 WP_000804320.1.22790 WP_000804320.1.22792 WP_000804320.1.22803 WP_000804320.1.22853 WP_000804320.1.22869 WP_000804320.1.22890 WP_000804320.1.22969 WP_000804320.1.22975 WP_000804320.1.23008 WP_000804320.1.23048 WP_000804320.1.23061 WP_000804320.1.23069 WP_000804320.1.23082 WP_000804320.1.23103 WP_000804320.1.23121 WP_000804320.1.23130 WP_000804320.1.23132 WP_000804320.1.23133 WP_000804320.1.23161 WP_000804320.1.23185 WP_000804320.1.23197 WP_000804320.1.23217 WP_000804320.1.23244 WP_000804320.1.2327 WP_000804320.1.23275 WP_000804320.1.23288 WP_000804320.1.23413 WP_000804320.1.23449 WP_000804320.1.23516 WP_000804320.1.23531 WP_000804320.1.23568 WP_000804320.1.23572 WP_000804320.1.23630 WP_000804320.1.23644 WP_000804320.1.23690 WP_000804320.1.23740 WP_000804320.1.23796 WP_000804320.1.23809 WP_000804320.1.2382 WP_000804320.1.23842 WP_000804320.1.23856 WP_000804320.1.2389 WP_000804320.1.23896 WP_000804320.1.23900 WP_000804320.1.23956 WP_000804320.1.23972 WP_000804320.1.23995 WP_000804320.1.24000 WP_000804320.1.24129 WP_000804320.1.24174 WP_000804320.1.2420 WP_000804320.1.24207 WP_000804320.1.24213 WP_000804320.1.24263 WP_000804320.1.2427 WP_000804320.1.24275 WP_000804320.1.24277 WP_000804320.1.24343 WP_000804320.1.24416 WP_000804320.1.24436 WP_000804320.1.24437 WP_000804320.1.24439 WP_000804320.1.24469 WP_000804320.1.2450 WP_000804320.1.24519 WP_000804320.1.24589 WP_000804320.1.24596 WP_000804320.1.24602 WP_000804320.1.24631 WP_000804320.1.24679 WP_000804320.1.24684 WP_000804320.1.24823 WP_000804320.1.24855 WP_000804320.1.24903 WP_000804320.1.2497 WP_000804320.1.25007 WP_000804320.1.2501 WP_000804320.1.25012 WP_000804320.1.25029 WP_000804320.1.2506 WP_000804320.1.25092 WP_000804320.1.25098 WP_000804320.1.25115 WP_000804320.1.25120 WP_000804320.1.25145 WP_000804320.1.25209 WP_000804320.1.2522 WP_000804320.1.25287 WP_000804320.1.25331 WP_000804320.1.25361 WP_000804320.1.25433 WP_000804320.1.25459 WP_000804320.1.25489 WP_000804320.1.2552 WP_000804320.1.25557 WP_000804320.1.25595 WP_000804320.1.25621 WP_000804320.1.25623 WP_000804320.1.257 WP_000804320.1.25721 WP_000804320.1.25758 WP_000804320.1.25772 WP_000804320.1.25776 WP_000804320.1.25779 WP_000804320.1.25802 WP_000804320.1.25840 WP_000804320.1.25852 WP_000804320.1.25856 WP_000804320.1.25857 WP_000804320.1.2590 WP_000804320.1.25910 WP_000804320.1.25930 WP_000804320.1.25984 WP_000804320.1.26033 WP_000804320.1.26039 WP_000804320.1.2608 WP_000804320.1.26086 WP_000804320.1.26106 WP_000804320.1.26143 WP_000804320.1.26169 WP_000804320.1.26172 WP_000804320.1.2619 WP_000804320.1.26226 WP_000804320.1.26255 WP_000804320.1.26266 WP_000804320.1.26276 WP_000804320.1.26289 WP_000804320.1.26290 WP_000804320.1.26298 WP_000804320.1.26314 WP_000804320.1.26318 WP_000804320.1.2633 WP_000804320.1.26340 WP_000804320.1.26345 WP_000804320.1.26354 WP_000804320.1.26359 WP_000804320.1.26364 WP_000804320.1.26397 WP_000804320.1.26399 WP_000804320.1.26404 WP_000804320.1.2643 WP_000804320.1.26506 WP_000804320.1.26584 WP_000804320.1.26662 WP_000804320.1.26677 WP_000804320.1.26692 WP_000804320.1.2673 WP_000804320.1.26749 WP_000804320.1.26751 WP_000804320.1.26772 WP_000804320.1.26804 WP_000804320.1.2684 WP_000804320.1.26840 WP_000804320.1.26850 WP_000804320.1.26865 WP_000804320.1.2687 WP_000804320.1.26884 WP_000804320.1.2689 WP_000804320.1.26903 WP_000804320.1.26905 WP_000804320.1.26929 WP_000804320.1.26938 WP_000804320.1.26944 WP_000804320.1.26963 WP_000804320.1.2697 WP_000804320.1.27013 WP_000804320.1.27053 WP_000804320.1.27080 WP_000804320.1.27083 WP_000804320.1.27166 WP_000804320.1.27168 WP_000804320.1.27170 WP_000804320.1.27182 WP_000804320.1.2719 WP_000804320.1.27262 WP_000804320.1.27294 WP_000804320.1.27323 WP_000804320.1.27379 WP_000804320.1.27387 WP_000804320.1.27447 WP_000804320.1.27456 WP_000804320.1.27467 WP_000804320.1.27468 WP_000804320.1.2753 WP_000804320.1.27539 WP_000804320.1.27590 WP_000804320.1.27628 WP_000804320.1.27640 WP_000804320.1.27646 WP_000804320.1.27689 WP_000804320.1.27696 WP_000804320.1.27744 WP_000804320.1.27765 WP_000804320.1.27793 WP_000804320.1.27799 WP_000804320.1.27830 WP_000804320.1.27929 WP_000804320.1.2795 WP_000804320.1.28016 WP_000804320.1.28079 WP_000804320.1.28091 WP_000804320.1.28105 WP_000804320.1.28173 WP_000804320.1.28213 WP_000804320.1.28226 WP_000804320.1.28230 WP_000804320.1.28253 WP_000804320.1.28257 WP_000804320.1.28274 WP_000804320.1.28315 WP_000804320.1.28319 WP_000804320.1.28334 WP_000804320.1.28347 WP_000804320.1.28399 WP_000804320.1.28400 WP_000804320.1.28430 WP_000804320.1.28447 WP_000804320.1.28482 WP_000804320.1.2852 WP_000804320.1.28564 WP_000804320.1.28578 WP_000804320.1.28580 WP_000804320.1.28584 WP_000804320.1.28605 WP_000804320.1.28614 WP_000804320.1.2862 WP_000804320.1.28720 WP_000804320.1.28763 WP_000804320.1.28784 WP_000804320.1.28785 WP_000804320.1.28848 WP_000804320.1.28871 WP_000804320.1.28909 WP_000804320.1.2891 WP_000804320.1.28981 WP_000804320.1.28987 WP_000804320.1.29014 WP_000804320.1.29052 WP_000804320.1.29112 WP_000804320.1.2913 WP_000804320.1.29155 WP_000804320.1.29166 WP_000804320.1.29187 WP_000804320.1.29226 WP_000804320.1.29242 WP_000804320.1.29244 WP_000804320.1.29263 WP_000804320.1.29276 WP_000804320.1.29301 WP_000804320.1.29329 WP_000804320.1.29368 WP_000804320.1.29395 WP_000804320.1.29420 WP_000804320.1.29468 WP_000804320.1.29522 WP_000804320.1.29553 WP_000804320.1.29554 WP_000804320.1.2957 WP_000804320.1.2972 WP_000804320.1.29731 WP_000804320.1.29736 WP_000804320.1.29744 WP_000804320.1.29788 WP_000804320.1.2981 WP_000804320.1.2983 WP_000804320.1.29862 WP_000804320.1.29902 WP_000804320.1.29905 WP_000804320.1.29918 WP_000804320.1.29956 WP_000804320.1.2997 WP_000804320.1.29981 WP_000804320.1.29982 WP_000804320.1.30051 WP_000804320.1.30089 WP_000804320.1.30095 WP_000804320.1.30100 WP_000804320.1.30130 WP_000804320.1.30191 WP_000804320.1.30197 WP_000804320.1.30204 WP_000804320.1.30209 WP_000804320.1.30249 WP_000804320.1.30268 WP_000804320.1.30302 WP_000804320.1.30307 WP_000804320.1.30328 WP_000804320.1.30350 WP_000804320.1.30364 WP_000804320.1.30385 WP_000804320.1.30508 WP_000804320.1.30531 WP_000804320.1.30560 WP_000804320.1.30566 WP_000804320.1.30568 WP_000804320.1.30622 WP_000804320.1.30645 WP_000804320.1.30646 WP_000804320.1.30648 WP_000804320.1.30650 WP_000804320.1.30652 WP_000804320.1.30666 WP_000804320.1.30702 WP_000804320.1.30720 WP_000804320.1.30726 WP_000804320.1.30763 WP_000804320.1.3077 WP_000804320.1.30845 WP_000804320.1.30847 WP_000804320.1.30854 WP_000804320.1.30880 WP_000804320.1.30907 WP_000804320.1.30915 WP_000804320.1.30928 WP_000804320.1.31005 WP_000804320.1.31022 WP_000804320.1.31039 WP_000804320.1.31041 WP_000804320.1.31048 WP_000804320.1.31065 WP_000804320.1.31077 WP_000804320.1.31113 WP_000804320.1.31176 WP_000804320.1.31206 WP_000804320.1.31278 WP_000804320.1.31315 WP_000804320.1.31337 WP_000804320.1.31339 WP_000804320.1.31355 WP_000804320.1.31437 WP_000804320.1.31442 WP_000804320.1.31468 WP_000804320.1.31479 WP_000804320.1.31497 WP_000804320.1.31529 WP_000804320.1.31539 WP_000804320.1.31568 WP_000804320.1.31589 WP_000804320.1.31605 WP_000804320.1.31642 WP_000804320.1.31647 WP_000804320.1.31653 WP_000804320.1.31686 WP_000804320.1.31743 WP_000804320.1.31753 WP_000804320.1.31791 WP_000804320.1.31827 WP_000804320.1.31828 WP_000804320.1.31842 WP_000804320.1.3188 WP_000804320.1.31892 WP_000804320.1.31931 WP_000804320.1.31997 WP_000804320.1.32003 WP_000804320.1.32029 WP_000804320.1.32067 WP_000804320.1.32077 WP_000804320.1.32160 WP_000804320.1.32207 WP_000804320.1.3229 WP_000804320.1.3231 WP_000804320.1.32339 WP_000804320.1.3242 WP_000804320.1.32474 WP_000804320.1.32481 WP_000804320.1.32483 WP_000804320.1.32514 WP_000804320.1.32555 WP_000804320.1.32565 WP_000804320.1.32599 WP_000804320.1.32607 WP_000804320.1.32634 WP_000804320.1.32645 WP_000804320.1.32746 WP_000804320.1.32761 WP_000804320.1.32763 WP_000804320.1.32764 WP_000804320.1.32770 WP_000804320.1.32800 WP_000804320.1.32829 WP_000804320.1.32928 WP_000804320.1.32939 WP_000804320.1.32954 WP_000804320.1.32965 WP_000804320.1.33029 WP_000804320.1.33038 WP_000804320.1.33048 WP_000804320.1.33067 WP_000804320.1.33110 WP_000804320.1.33123 WP_000804320.1.33138 WP_000804320.1.33212 WP_000804320.1.33250 WP_000804320.1.33266 WP_000804320.1.33296 WP_000804320.1.3330 WP_000804320.1.33322 WP_000804320.1.33328 WP_000804320.1.33335 WP_000804320.1.33357 WP_000804320.1.33416 WP_000804320.1.3342 WP_000804320.1.3343 WP_000804320.1.33432 WP_000804320.1.33468 WP_000804320.1.3347 WP_000804320.1.33507 WP_000804320.1.33538 WP_000804320.1.33567 WP_000804320.1.33594 WP_000804320.1.33607 WP_000804320.1.33626 WP_000804320.1.33627 WP_000804320.1.3363 WP_000804320.1.33654 WP_000804320.1.33655 WP_000804320.1.33692 WP_000804320.1.33695 WP_000804320.1.33707 WP_000804320.1.33718 WP_000804320.1.33735 WP_000804320.1.33743 WP_000804320.1.33767 WP_000804320.1.33769 WP_000804320.1.33792 WP_000804320.1.33804 WP_000804320.1.33813 WP_000804320.1.33850 WP_000804320.1.33940 WP_000804320.1.33968 WP_000804320.1.33971 WP_000804320.1.33983 WP_000804320.1.33989 WP_000804320.1.34026 WP_000804320.1.34030 WP_000804320.1.34051 WP_000804320.1.34060 WP_000804320.1.34062 WP_000804320.1.34078 WP_000804320.1.34100 WP_000804320.1.34132 WP_000804320.1.34182 WP_000804320.1.34209 WP_000804320.1.34244 WP_000804320.1.34250 WP_000804320.1.34251 WP_000804320.1.34254 WP_000804320.1.34285 WP_000804320.1.34381 WP_000804320.1.34403 WP_000804320.1.34410 WP_000804320.1.34427 WP_000804320.1.34436 WP_000804320.1.34473 WP_000804320.1.34492 WP_000804320.1.34502 WP_000804320.1.34510 WP_000804320.1.34526 WP_000804320.1.3461 WP_000804320.1.34620 WP_000804320.1.34677 WP_000804320.1.34733 WP_000804320.1.34737 WP_000804320.1.34767 WP_000804320.1.34774 WP_000804320.1.34818 WP_000804320.1.34890 WP_000804320.1.34912 WP_000804320.1.34918 WP_000804320.1.34943 WP_000804320.1.34998 WP_000804320.1.35054 WP_000804320.1.35059 WP_000804320.1.35062 WP_000804320.1.35089 WP_000804320.1.35097 WP_000804320.1.35110 WP_000804320.1.35121 WP_000804320.1.35182 WP_000804320.1.35194 WP_000804320.1.35233 WP_000804320.1.35276 WP_000804320.1.35285 WP_000804320.1.35297 WP_000804320.1.35334 WP_000804320.1.35342 WP_000804320.1.354 WP_000804320.1.35415 WP_000804320.1.35423 WP_000804320.1.3547 WP_000804320.1.3549 WP_000804320.1.35498 WP_000804320.1.35506 WP_000804320.1.35525 WP_000804320.1.35580 WP_000804320.1.35615 WP_000804320.1.35623 WP_000804320.1.35673 WP_000804320.1.3569 WP_000804320.1.35730 WP_000804320.1.3574 WP_000804320.1.35801 WP_000804320.1.35826 WP_000804320.1.35888 WP_000804320.1.35900 WP_000804320.1.35928 WP_000804320.1.35950 WP_000804320.1.35958 WP_000804320.1.36004 WP_000804320.1.36041 WP_000804320.1.36082 WP_000804320.1.36102 WP_000804320.1.3611 WP_000804320.1.36119 WP_000804320.1.36141 WP_000804320.1.3617 WP_000804320.1.36176 WP_000804320.1.36187 WP_000804320.1.36188 WP_000804320.1.36250 WP_000804320.1.36264 WP_000804320.1.36278 WP_000804320.1.36282 WP_000804320.1.36307 WP_000804320.1.36344 WP_000804320.1.36389 WP_000804320.1.36532 WP_000804320.1.36535 WP_000804320.1.3655 WP_000804320.1.36570 WP_000804320.1.36580 WP_000804320.1.36600 WP_000804320.1.36615 WP_000804320.1.36646 WP_000804320.1.3666 WP_000804320.1.36689 WP_000804320.1.36697 WP_000804320.1.36698 WP_000804320.1.36745 WP_000804320.1.36754 WP_000804320.1.36783 WP_000804320.1.36793 WP_000804320.1.36796 WP_000804320.1.36797 WP_000804320.1.36822 WP_000804320.1.3685 WP_000804320.1.36858 WP_000804320.1.3687 WP_000804320.1.3690 WP_000804320.1.36916 WP_000804320.1.36955 WP_000804320.1.36962 WP_000804320.1.36979 WP_000804320.1.36980 WP_000804320.1.36997 WP_000804320.1.37002 WP_000804320.1.37016 WP_000804320.1.3703 WP_000804320.1.37044 WP_000804320.1.37045 WP_000804320.1.37055 WP_000804320.1.37080 WP_000804320.1.37091 WP_000804320.1.37121 WP_000804320.1.37134 WP_000804320.1.3718 WP_000804320.1.3719 WP_000804320.1.37220 WP_000804320.1.37341 WP_000804320.1.37398 WP_000804320.1.37424 WP_000804320.1.37453 WP_000804320.1.37467 WP_000804320.1.37583 WP_000804320.1.37602 WP_000804320.1.37605 WP_000804320.1.37606 WP_000804320.1.37621 WP_000804320.1.37624 WP_000804320.1.3776 WP_000804320.1.37781 WP_000804320.1.37815 WP_000804320.1.37828 WP_000804320.1.37866 WP_000804320.1.37875 WP_000804320.1.37891 WP_000804320.1.37953 WP_000804320.1.37987 WP_000804320.1.38020 WP_000804320.1.38034 WP_000804320.1.38038 WP_000804320.1.38057 WP_000804320.1.38070 WP_000804320.1.38082 WP_000804320.1.3809 WP_000804320.1.38100 WP_000804320.1.3813 WP_000804320.1.38160 WP_000804320.1.3817 WP_000804320.1.38177 WP_000804320.1.3820 WP_000804320.1.38230 WP_000804320.1.38232 WP_000804320.1.38276 WP_000804320.1.38282 WP_000804320.1.38309 WP_000804320.1.38339 WP_000804320.1.38383 WP_000804320.1.3842 WP_000804320.1.38437 WP_000804320.1.38453 WP_000804320.1.38493 WP_000804320.1.38522 WP_000804320.1.38546 WP_000804320.1.38557 WP_000804320.1.38607 WP_000804320.1.38612 WP_000804320.1.3867 WP_000804320.1.38674 WP_000804320.1.38721 WP_000804320.1.38760 WP_000804320.1.38786 WP_000804320.1.38823 WP_000804320.1.38841 WP_000804320.1.38858 WP_000804320.1.38926 WP_000804320.1.38931 WP_000804320.1.38940 WP_000804320.1.38941 WP_000804320.1.38943 WP_000804320.1.38972 WP_000804320.1.38979 WP_000804320.1.38985 WP_000804320.1.38989 WP_000804320.1.390 WP_000804320.1.39012 WP_000804320.1.39014 WP_000804320.1.39043 WP_000804320.1.39053 WP_000804320.1.3906 WP_000804320.1.3908 WP_000804320.1.391 WP_000804320.1.39173 WP_000804320.1.39203 WP_000804320.1.39206 WP_000804320.1.39217 WP_000804320.1.39241 WP_000804320.1.3926 WP_000804320.1.39272 WP_000804320.1.39285 WP_000804320.1.39290 WP_000804320.1.39332 WP_000804320.1.39333 WP_000804320.1.39378 WP_000804320.1.39397 WP_000804320.1.39406 WP_000804320.1.39486 WP_000804320.1.39506 WP_000804320.1.39519 WP_000804320.1.39550 WP_000804320.1.39613 WP_000804320.1.39645 WP_000804320.1.39687 WP_000804320.1.39689 WP_000804320.1.39697 WP_000804320.1.39711 WP_000804320.1.39738 WP_000804320.1.39767 WP_000804320.1.39789 WP_000804320.1.39832 WP_000804320.1.39838 WP_000804320.1.39856 WP_000804320.1.39869 WP_000804320.1.40014 WP_000804320.1.40043 WP_000804320.1.40099 WP_000804320.1.40120 WP_000804320.1.40161 WP_000804320.1.40164 WP_000804320.1.40173 WP_000804320.1.4019 WP_000804320.1.40318 WP_000804320.1.40320 WP_000804320.1.40330 WP_000804320.1.40342 WP_000804320.1.40368 WP_000804320.1.40383 WP_000804320.1.40401 WP_000804320.1.40406 WP_000804320.1.4045 WP_000804320.1.40474 WP_000804320.1.40481 WP_000804320.1.40505 WP_000804320.1.40531 WP_000804320.1.40532 WP_000804320.1.40554 WP_000804320.1.4056 WP_000804320.1.40579 WP_000804320.1.40588 WP_000804320.1.40620 WP_000804320.1.40644 WP_000804320.1.40655 WP_000804320.1.40658 WP_000804320.1.40659 WP_000804320.1.40748 WP_000804320.1.40760 WP_000804320.1.40797 WP_000804320.1.40800 WP_000804320.1.40816 WP_000804320.1.41011 WP_000804320.1.4102 WP_000804320.1.41058 WP_000804320.1.41064 WP_000804320.1.41084 WP_000804320.1.41094 WP_000804320.1.41104 WP_000804320.1.41119 WP_000804320.1.41122 WP_000804320.1.41129 WP_000804320.1.41133 WP_000804320.1.4115 WP_000804320.1.41178 WP_000804320.1.41208 WP_000804320.1.41241 WP_000804320.1.41255 WP_000804320.1.41289 WP_000804320.1.4129 WP_000804320.1.41426 WP_000804320.1.41433 WP_000804320.1.4144 WP_000804320.1.41473 WP_000804320.1.41499 WP_000804320.1.41511 WP_000804320.1.41532 WP_000804320.1.41533 WP_000804320.1.41558 WP_000804320.1.41567 WP_000804320.1.41582 WP_000804320.1.41623 WP_000804320.1.41674 WP_000804320.1.41817 WP_000804320.1.41839 WP_000804320.1.4188 WP_000804320.1.41891 WP_000804320.1.41898 WP_000804320.1.41935 WP_000804320.1.41943 WP_000804320.1.41989 WP_000804320.1.420 WP_000804320.1.42001 WP_000804320.1.42015 WP_000804320.1.42017 WP_000804320.1.42028 WP_000804320.1.42064 WP_000804320.1.42087 WP_000804320.1.42125 WP_000804320.1.42198 WP_000804320.1.42269 WP_000804320.1.42305 WP_000804320.1.42355 WP_000804320.1.42403 WP_000804320.1.42436 WP_000804320.1.42459 WP_000804320.1.42460 WP_000804320.1.42481 WP_000804320.1.42510 WP_000804320.1.42551 WP_000804320.1.42593 WP_000804320.1.426 WP_000804320.1.42640 WP_000804320.1.42652 WP_000804320.1.42668 WP_000804320.1.42674 WP_000804320.1.42679 WP_000804320.1.42737 WP_000804320.1.42738 WP_000804320.1.42740 WP_000804320.1.42759 WP_000804320.1.42786 WP_000804320.1.42819 WP_000804320.1.42837 WP_000804320.1.42848 WP_000804320.1.42883 WP_000804320.1.42897 WP_000804320.1.4293 WP_000804320.1.4299 WP_000804320.1.43014 WP_000804320.1.43020 WP_000804320.1.43047 WP_000804320.1.43072 WP_000804320.1.43114 WP_000804320.1.43122 WP_000804320.1.43131 WP_000804320.1.43134 WP_000804320.1.43143 WP_000804320.1.43147 WP_000804320.1.43159 WP_000804320.1.43165 WP_000804320.1.43200 WP_000804320.1.43202 WP_000804320.1.43206 WP_000804320.1.43232 WP_000804320.1.43248 WP_000804320.1.4325 WP_000804320.1.43263 WP_000804320.1.4327 WP_000804320.1.43274 WP_000804320.1.43341 WP_000804320.1.43349 WP_000804320.1.43369 WP_000804320.1.4337 WP_000804320.1.43406 WP_000804320.1.4341 WP_000804320.1.43410 WP_000804320.1.43414 WP_000804320.1.43460 WP_000804320.1.4347 WP_000804320.1.43506 WP_000804320.1.43550 WP_000804320.1.43560 WP_000804320.1.43617 WP_000804320.1.43618 WP_000804320.1.43627 WP_000804320.1.43659 WP_000804320.1.43670 WP_000804320.1.43702 WP_000804320.1.4372 WP_000804320.1.43731 WP_000804320.1.43752 WP_000804320.1.43788 WP_000804320.1.43819 WP_000804320.1.43827 WP_000804320.1.4385 WP_000804320.1.43904 WP_000804320.1.43915 WP_000804320.1.43984 WP_000804320.1.43988 WP_000804320.1.44119 WP_000804320.1.44153 WP_000804320.1.44181 WP_000804320.1.44186 WP_000804320.1.44195 WP_000804320.1.44265 WP_000804320.1.44302 WP_000804320.1.44331 WP_000804320.1.44388 WP_000804320.1.44396 WP_000804320.1.44405 WP_000804320.1.44420 WP_000804320.1.44536 WP_000804320.1.44544 WP_000804320.1.44579 WP_000804320.1.44588 WP_000804320.1.44605 WP_000804320.1.44631 WP_000804320.1.44672 WP_000804320.1.44732 WP_000804320.1.44755 WP_000804320.1.44780 WP_000804320.1.44785 WP_000804320.1.44788 WP_000804320.1.44796 WP_000804320.1.44881 WP_000804320.1.44882 WP_000804320.1.44914 WP_000804320.1.44969 WP_000804320.1.4499 WP_000804320.1.45008 WP_000804320.1.45033 WP_000804320.1.45035 WP_000804320.1.45099 WP_000804320.1.45114 WP_000804320.1.4513 WP_000804320.1.45133 WP_000804320.1.45164 WP_000804320.1.45170 WP_000804320.1.45221 WP_000804320.1.45272 WP_000804320.1.45290 WP_000804320.1.45297 WP_000804320.1.453 WP_000804320.1.45364 WP_000804320.1.45419 WP_000804320.1.45431 WP_000804320.1.45439 WP_000804320.1.45472 WP_000804320.1.4550 WP_000804320.1.45507 WP_000804320.1.45560 WP_000804320.1.45577 WP_000804320.1.45670 WP_000804320.1.45698 WP_000804320.1.45734 WP_000804320.1.45768 WP_000804320.1.45771 WP_000804320.1.45780 WP_000804320.1.4584 WP_000804320.1.45852 WP_000804320.1.45878 WP_000804320.1.45897 WP_000804320.1.45954 WP_000804320.1.4598 WP_000804320.1.46003 WP_000804320.1.46005 WP_000804320.1.46013 WP_000804320.1.46055 WP_000804320.1.46087 WP_000804320.1.46109 WP_000804320.1.46168 WP_000804320.1.46208 WP_000804320.1.46222 WP_000804320.1.46228 WP_000804320.1.46276 WP_000804320.1.46330 WP_000804320.1.46334 WP_000804320.1.46362 WP_000804320.1.46368 WP_000804320.1.46380 WP_000804320.1.46401 WP_000804320.1.46422 WP_000804320.1.46465 WP_000804320.1.46543 WP_000804320.1.46587 WP_000804320.1.4662 WP_000804320.1.46660 WP_000804320.1.46664 WP_000804320.1.46670 WP_000804320.1.46692 WP_000804320.1.46702 WP_000804320.1.46703 WP_000804320.1.46752 WP_000804320.1.46765 WP_000804320.1.46852 WP_000804320.1.46881 WP_000804320.1.46908 WP_000804320.1.46925 WP_000804320.1.46937 WP_000804320.1.4696 WP_000804320.1.46965 WP_000804320.1.46983 WP_000804320.1.46995 WP_000804320.1.47051 WP_000804320.1.47128 WP_000804320.1.47153 WP_000804320.1.47159 WP_000804320.1.47163 WP_000804320.1.47175 WP_000804320.1.47187 WP_000804320.1.47211 WP_000804320.1.47216 WP_000804320.1.47258 WP_000804320.1.47276 WP_000804320.1.47279 WP_000804320.1.4728 WP_000804320.1.47290 WP_000804320.1.47294 WP_000804320.1.47306 WP_000804320.1.47328 WP_000804320.1.47381 WP_000804320.1.47399 WP_000804320.1.47406 WP_000804320.1.47426 WP_000804320.1.47432 WP_000804320.1.47439 WP_000804320.1.47560 WP_000804320.1.47618 WP_000804320.1.4767 WP_000804320.1.477 WP_000804320.1.47702 WP_000804320.1.47719 WP_000804320.1.47733 WP_000804320.1.47763 WP_000804320.1.47782 WP_000804320.1.47835 WP_000804320.1.47836 WP_000804320.1.47859 WP_000804320.1.47864 WP_000804320.1.47872 WP_000804320.1.47873 WP_000804320.1.47904 WP_000804320.1.47989 WP_000804320.1.47996 WP_000804320.1.48011 WP_000804320.1.48030 WP_000804320.1.48047 WP_000804320.1.4805 WP_000804320.1.48149 WP_000804320.1.4815 WP_000804320.1.48169 WP_000804320.1.48186 WP_000804320.1.48227 WP_000804320.1.48250 WP_000804320.1.48284 WP_000804320.1.48293 WP_000804320.1.48307 WP_000804320.1.48322 WP_000804320.1.48391 WP_000804320.1.48394 WP_000804320.1.48425 WP_000804320.1.48463 WP_000804320.1.48563 WP_000804320.1.48577 WP_000804320.1.48593 WP_000804320.1.48634 WP_000804320.1.48656 WP_000804320.1.4868 WP_000804320.1.48705 WP_000804320.1.48711 WP_000804320.1.48775 WP_000804320.1.48817 WP_000804320.1.48818 WP_000804320.1.48823 WP_000804320.1.48833 WP_000804320.1.48835 WP_000804320.1.4886 WP_000804320.1.48936 WP_000804320.1.48941 WP_000804320.1.48945 WP_000804320.1.48951 WP_000804320.1.48966 WP_000804320.1.48968 WP_000804320.1.48982 WP_000804320.1.48993 WP_000804320.1.4901 WP_000804320.1.49032 WP_000804320.1.4905 WP_000804320.1.49128 WP_000804320.1.49129 WP_000804320.1.49154 WP_000804320.1.49159 WP_000804320.1.4916 WP_000804320.1.49161 WP_000804320.1.4917 WP_000804320.1.49173 WP_000804320.1.4918 WP_000804320.1.49207 WP_000804320.1.49234 WP_000804320.1.49248 WP_000804320.1.49327 WP_000804320.1.49330 WP_000804320.1.49398 WP_000804320.1.49479 WP_000804320.1.4950 WP_000804320.1.49539 WP_000804320.1.4962 WP_000804320.1.49653 WP_000804320.1.49669 WP_000804320.1.49704 WP_000804320.1.49715 WP_000804320.1.49730 WP_000804320.1.49742 WP_000804320.1.4980 WP_000804320.1.49860 WP_000804320.1.49863 WP_000804320.1.49871 WP_000804320.1.4989 WP_000804320.1.49894 WP_000804320.1.49907 WP_000804320.1.49913 WP_000804320.1.49934 WP_000804320.1.49936 WP_000804320.1.4994 WP_000804320.1.49970 WP_000804320.1.49982 WP_000804320.1.50013 WP_000804320.1.50015 WP_000804320.1.50038 WP_000804320.1.50039 WP_000804320.1.50061 WP_000804320.1.50076 WP_000804320.1.5013 WP_000804320.1.50138 WP_000804320.1.50217 WP_000804320.1.50219 WP_000804320.1.50229 WP_000804320.1.50261 WP_000804320.1.50313 WP_000804320.1.50314 WP_000804320.1.50356 WP_000804320.1.50360 WP_000804320.1.50425 WP_000804320.1.50430 WP_000804320.1.50431 WP_000804320.1.50477 WP_000804320.1.50516 WP_000804320.1.50536 WP_000804320.1.50555 WP_000804320.1.50578 WP_000804320.1.50595 WP_000804320.1.50660 WP_000804320.1.50669 WP_000804320.1.50759 WP_000804320.1.50768 WP_000804320.1.50799 WP_000804320.1.50820 WP_000804320.1.50827 WP_000804320.1.5087 WP_000804320.1.50884 WP_000804320.1.50896 WP_000804320.1.50937 WP_000804320.1.50962 WP_000804320.1.51008 WP_000804320.1.51062 WP_000804320.1.51085 WP_000804320.1.5109 WP_000804320.1.5110 WP_000804320.1.5111 WP_000804320.1.51138 WP_000804320.1.51152 WP_000804320.1.51236 WP_000804320.1.51245 WP_000804320.1.51250 WP_000804320.1.51282 WP_000804320.1.51295 WP_000804320.1.51306 WP_000804320.1.51310 WP_000804320.1.51346 WP_000804320.1.51376 WP_000804320.1.51403 WP_000804320.1.51454 WP_000804320.1.51456 WP_000804320.1.51492 WP_000804320.1.515 WP_000804320.1.51527 WP_000804320.1.5155 WP_000804320.1.51559 WP_000804320.1.51575 WP_000804320.1.51590 WP_000804320.1.51665 WP_000804320.1.51716 WP_000804320.1.51744 WP_000804320.1.51748 WP_000804320.1.51787 WP_000804320.1.51797 WP_000804320.1.51812 WP_000804320.1.51836 WP_000804320.1.51842 WP_000804320.1.51844 WP_000804320.1.51871 WP_000804320.1.51883 WP_000804320.1.5190 WP_000804320.1.51912 WP_000804320.1.51920 WP_000804320.1.51924 WP_000804320.1.51936 WP_000804320.1.51952 WP_000804320.1.51971 WP_000804320.1.51995 WP_000804320.1.52078 WP_000804320.1.521 WP_000804320.1.5213 WP_000804320.1.52151 WP_000804320.1.52162 WP_000804320.1.52182 WP_000804320.1.52185 WP_000804320.1.52193 WP_000804320.1.52251 WP_000804320.1.52252 WP_000804320.1.52259 WP_000804320.1.52296 WP_000804320.1.523 WP_000804320.1.52322 WP_000804320.1.52327 WP_000804320.1.52331 WP_000804320.1.52340 WP_000804320.1.52440 WP_000804320.1.52442 WP_000804320.1.52518 WP_000804320.1.52536 WP_000804320.1.52548 WP_000804320.1.52595 WP_000804320.1.52623 WP_000804320.1.52624 WP_000804320.1.52633 WP_000804320.1.52645 WP_000804320.1.52670 WP_000804320.1.52687 WP_000804320.1.52699 WP_000804320.1.52715 WP_000804320.1.52722 WP_000804320.1.52772 WP_000804320.1.52820 WP_000804320.1.52838 WP_000804320.1.52848 WP_000804320.1.52877 WP_000804320.1.52878 WP_000804320.1.52904 WP_000804320.1.52941 WP_000804320.1.52947 WP_000804320.1.52984 WP_000804320.1.53002 WP_000804320.1.53007 WP_000804320.1.53071 WP_000804320.1.53077 WP_000804320.1.53140 WP_000804320.1.53153 WP_000804320.1.53178 WP_000804320.1.53209 WP_000804320.1.53260 WP_000804320.1.53317 WP_000804320.1.53319 WP_000804320.1.53394 WP_000804320.1.53403 WP_000804320.1.53432 WP_000804320.1.53462 WP_000804320.1.53521 WP_000804320.1.53577 WP_000804320.1.53641 WP_000804320.1.53648 WP_000804320.1.53661 WP_000804320.1.53671 WP_000804320.1.53682 WP_000804320.1.53691 WP_000804320.1.53712 WP_000804320.1.53714 WP_000804320.1.53759 WP_000804320.1.53763 WP_000804320.1.53766 WP_000804320.1.53786 WP_000804320.1.53827 WP_000804320.1.53835 WP_000804320.1.53889 WP_000804320.1.53915 WP_000804320.1.53969 WP_000804320.1.53999 WP_000804320.1.5401 WP_000804320.1.54022 WP_000804320.1.54109 WP_000804320.1.54135 WP_000804320.1.54147 WP_000804320.1.54229 WP_000804320.1.54253 WP_000804320.1.54269 WP_000804320.1.54297 WP_000804320.1.54373 WP_000804320.1.54395 WP_000804320.1.544 WP_000804320.1.54413 WP_000804320.1.54477 WP_000804320.1.54491 WP_000804320.1.54503 WP_000804320.1.54510 WP_000804320.1.54543 WP_000804320.1.54551 WP_000804320.1.54637 WP_000804320.1.54675 WP_000804320.1.5469 WP_000804320.1.54745 WP_000804320.1.54753 WP_000804320.1.54847 WP_000804320.1.54878 WP_000804320.1.54914 WP_000804320.1.54955 WP_000804320.1.55014 WP_000804320.1.55058 WP_000804320.1.55090 WP_000804320.1.5519 WP_000804320.1.55214 WP_000804320.1.55274 WP_000804320.1.55309 WP_000804320.1.55352 WP_000804320.1.55367 WP_000804320.1.55369 WP_000804320.1.55403 WP_000804320.1.55405 WP_000804320.1.55421 WP_000804320.1.55508 WP_000804320.1.5554 WP_000804320.1.55544 WP_000804320.1.55558 WP_000804320.1.5556 WP_000804320.1.55583 WP_000804320.1.5559 WP_000804320.1.55620 WP_000804320.1.55628 WP_000804320.1.55637 WP_000804320.1.5565 WP_000804320.1.55653 WP_000804320.1.557 WP_000804320.1.55728 WP_000804320.1.5575 WP_000804320.1.55786 WP_000804320.1.5580 WP_000804320.1.55818 WP_000804320.1.55831 WP_000804320.1.55835 WP_000804320.1.55839 WP_000804320.1.55848 WP_000804320.1.55859 WP_000804320.1.55867 WP_000804320.1.55886 WP_000804320.1.5589 WP_000804320.1.55904 WP_000804320.1.55916 WP_000804320.1.55933 WP_000804320.1.55953 WP_000804320.1.56000 WP_000804320.1.56025 WP_000804320.1.56048 WP_000804320.1.56078 WP_000804320.1.56098 WP_000804320.1.56099 WP_000804320.1.56210 WP_000804320.1.56213 WP_000804320.1.56225 WP_000804320.1.5623 WP_000804320.1.56239 WP_000804320.1.56241 WP_000804320.1.56260 WP_000804320.1.56272 WP_000804320.1.56275 WP_000804320.1.56281 WP_000804320.1.56332 WP_000804320.1.56333 WP_000804320.1.5635 WP_000804320.1.56364 WP_000804320.1.56400 WP_000804320.1.5644 WP_000804320.1.56522 WP_000804320.1.56558 WP_000804320.1.5658 WP_000804320.1.56598 WP_000804320.1.566 WP_000804320.1.56628 WP_000804320.1.56641 WP_000804320.1.56658 WP_000804320.1.5666 WP_000804320.1.56679 WP_000804320.1.56767 WP_000804320.1.5677 WP_000804320.1.56778 WP_000804320.1.56794 WP_000804320.1.56815 WP_000804320.1.56856 WP_000804320.1.5686 WP_000804320.1.56865 WP_000804320.1.56878 WP_000804320.1.569 WP_000804320.1.56986 WP_000804320.1.57047 WP_000804320.1.57073 WP_000804320.1.57075 WP_000804320.1.57097 WP_000804320.1.57109 WP_000804320.1.57158 WP_000804320.1.57170 WP_000804320.1.5718 WP_000804320.1.57190 WP_000804320.1.57214 WP_000804320.1.57265 WP_000804320.1.57271 WP_000804320.1.57291 WP_000804320.1.57309 WP_000804320.1.5735 WP_000804320.1.57385 WP_000804320.1.5743 WP_000804320.1.57445 WP_000804320.1.57481 WP_000804320.1.57594 WP_000804320.1.57612 WP_000804320.1.57635 WP_000804320.1.57650 WP_000804320.1.57665 WP_000804320.1.57682 WP_000804320.1.57692 WP_000804320.1.57730 WP_000804320.1.57734 WP_000804320.1.57754 WP_000804320.1.57808 WP_000804320.1.57819 WP_000804320.1.57837 WP_000804320.1.57840 WP_000804320.1.57861 WP_000804320.1.57878 WP_000804320.1.5791 WP_000804320.1.57928 WP_000804320.1.57943 WP_000804320.1.57952 WP_000804320.1.57974 WP_000804320.1.58016 WP_000804320.1.58049 WP_000804320.1.58074 WP_000804320.1.58116 WP_000804320.1.58127 WP_000804320.1.58139 WP_000804320.1.58148 WP_000804320.1.58158 WP_000804320.1.5816 WP_000804320.1.5827 WP_000804320.1.58277 WP_000804320.1.58317 WP_000804320.1.58352 WP_000804320.1.58364 WP_000804320.1.58395 WP_000804320.1.58430 WP_000804320.1.58435 WP_000804320.1.58512 WP_000804320.1.58530 WP_000804320.1.58571 WP_000804320.1.58584 WP_000804320.1.58588 WP_000804320.1.58592 WP_000804320.1.58598 WP_000804320.1.58704 WP_000804320.1.58735 WP_000804320.1.58760 WP_000804320.1.58763 WP_000804320.1.58772 WP_000804320.1.5880 WP_000804320.1.58833 WP_000804320.1.58855 WP_000804320.1.58934 WP_000804320.1.58981 WP_000804320.1.59011 WP_000804320.1.59014 WP_000804320.1.59039 WP_000804320.1.59077 WP_000804320.1.59098 WP_000804320.1.59124 WP_000804320.1.59146 WP_000804320.1.59178 WP_000804320.1.59187 WP_000804320.1.5920 WP_000804320.1.59311 WP_000804320.1.59334 WP_000804320.1.59337 WP_000804320.1.59398 WP_000804320.1.5940 WP_000804320.1.59404 WP_000804320.1.59414 WP_000804320.1.59462 WP_000804320.1.59464 WP_000804320.1.59498 WP_000804320.1.59540 WP_000804320.1.59546 WP_000804320.1.59594 WP_000804320.1.59598 WP_000804320.1.59624 WP_000804320.1.59643 WP_000804320.1.59668 WP_000804320.1.59669 WP_000804320.1.59671 WP_000804320.1.5972 WP_000804320.1.59736 WP_000804320.1.59787 WP_000804320.1.5982 WP_000804320.1.59822 WP_000804320.1.59864 WP_000804320.1.59874 WP_000804320.1.59907 WP_000804320.1.59915 WP_000804320.1.60006 WP_000804320.1.6006 WP_000804320.1.6011 WP_000804320.1.60118 WP_000804320.1.60123 WP_000804320.1.60147 WP_000804320.1.60149 WP_000804320.1.60157 WP_000804320.1.60158 WP_000804320.1.6017 WP_000804320.1.60227 WP_000804320.1.60302 WP_000804320.1.60339 WP_000804320.1.60345 WP_000804320.1.60353 WP_000804320.1.60355 WP_000804320.1.60360 WP_000804320.1.60434 WP_000804320.1.60492 WP_000804320.1.60547 WP_000804320.1.60585 WP_000804320.1.60595 WP_000804320.1.60636 WP_000804320.1.60641 WP_000804320.1.60719 WP_000804320.1.60730 WP_000804320.1.60750 WP_000804320.1.60751 WP_000804320.1.60758 WP_000804320.1.60759 WP_000804320.1.60765 WP_000804320.1.60778 WP_000804320.1.60813 WP_000804320.1.60820 WP_000804320.1.60845 WP_000804320.1.6085 WP_000804320.1.60859 WP_000804320.1.60869 WP_000804320.1.60888 WP_000804320.1.60912 WP_000804320.1.60923 WP_000804320.1.60934 WP_000804320.1.60948 WP_000804320.1.60965 WP_000804320.1.60991 WP_000804320.1.61013 WP_000804320.1.61019 WP_000804320.1.61026 WP_000804320.1.61029 WP_000804320.1.61031 WP_000804320.1.61082 WP_000804320.1.61115 WP_000804320.1.61139 WP_000804320.1.61189 WP_000804320.1.6119 WP_000804320.1.6123 WP_000804320.1.61263 WP_000804320.1.61271 WP_000804320.1.61289 WP_000804320.1.61313 WP_000804320.1.61316 WP_000804320.1.61318 WP_000804320.1.61346 WP_000804320.1.6136 WP_000804320.1.61375 WP_000804320.1.61394 WP_000804320.1.61430 WP_000804320.1.61439 WP_000804320.1.61440 WP_000804320.1.6149 WP_000804320.1.61515 WP_000804320.1.61555 WP_000804320.1.61585 WP_000804320.1.61597 WP_000804320.1.61615 WP_000804320.1.61639 WP_000804320.1.61653 WP_000804320.1.6166 WP_000804320.1.61705 WP_000804320.1.61709 WP_000804320.1.61713 WP_000804320.1.61749 WP_000804320.1.61776 WP_000804320.1.61800 WP_000804320.1.61802 WP_000804320.1.61831 WP_000804320.1.61838 WP_000804320.1.61843 WP_000804320.1.6188 WP_000804320.1.61903 WP_000804320.1.61936 WP_000804320.1.61962 WP_000804320.1.61976 WP_000804320.1.61978 WP_000804320.1.62002 WP_000804320.1.6201 WP_000804320.1.62028 WP_000804320.1.62069 WP_000804320.1.62071 WP_000804320.1.6208 WP_000804320.1.62096 WP_000804320.1.62127 WP_000804320.1.62247 WP_000804320.1.62254 WP_000804320.1.62346 WP_000804320.1.62352 WP_000804320.1.62382 WP_000804320.1.62392 WP_000804320.1.62398 WP_000804320.1.62429 WP_000804320.1.62453 WP_000804320.1.62462 WP_000804320.1.62474 WP_000804320.1.62496 WP_000804320.1.6250 WP_000804320.1.62553 WP_000804320.1.62563 WP_000804320.1.62602 WP_000804320.1.62630 WP_000804320.1.62653 WP_000804320.1.6266 WP_000804320.1.62671 WP_000804320.1.62674 WP_000804320.1.6268 WP_000804320.1.62684 WP_000804320.1.62723 WP_000804320.1.62764 WP_000804320.1.62771 WP_000804320.1.62822 WP_000804320.1.62824 WP_000804320.1.62831 WP_000804320.1.62863 WP_000804320.1.62880 WP_000804320.1.62925 WP_000804320.1.62970 WP_000804320.1.63003 WP_000804320.1.63021 WP_000804320.1.63027 WP_000804320.1.63070 WP_000804320.1.63083 WP_000804320.1.63107 WP_000804320.1.63139 WP_000804320.1.63140 WP_000804320.1.63255 WP_000804320.1.63266 WP_000804320.1.63288 WP_000804320.1.63289 WP_000804320.1.63304 WP_000804320.1.63313 WP_000804320.1.63333 WP_000804320.1.63341 WP_000804320.1.63441 WP_000804320.1.63469 WP_000804320.1.63471 WP_000804320.1.63540 WP_000804320.1.6355 WP_000804320.1.63589 WP_000804320.1.63672 WP_000804320.1.63673 WP_000804320.1.63678 WP_000804320.1.63704 WP_000804320.1.63726 WP_000804320.1.63729 WP_000804320.1.63751 WP_000804320.1.63759 WP_000804320.1.63763 WP_000804320.1.63774 WP_000804320.1.63828 WP_000804320.1.6388 WP_000804320.1.63890 WP_000804320.1.63907 WP_000804320.1.63998 WP_000804320.1.6403 WP_000804320.1.64060 WP_000804320.1.6408 WP_000804320.1.64181 WP_000804320.1.64192 WP_000804320.1.64232 WP_000804320.1.64250 WP_000804320.1.64367 WP_000804320.1.6438 WP_000804320.1.64408 WP_000804320.1.64434 WP_000804320.1.64440 WP_000804320.1.64446 WP_000804320.1.64456 WP_000804320.1.64457 WP_000804320.1.645 WP_000804320.1.64525 WP_000804320.1.6453 WP_000804320.1.64537 WP_000804320.1.64565 WP_000804320.1.64583 WP_000804320.1.6459 WP_000804320.1.64598 WP_000804320.1.64630 WP_000804320.1.64677 WP_000804320.1.64686 WP_000804320.1.64720 WP_000804320.1.64765 WP_000804320.1.6479 WP_000804320.1.64858 WP_000804320.1.64879 WP_000804320.1.6488 WP_000804320.1.64893 WP_000804320.1.64897 WP_000804320.1.64911 WP_000804320.1.64928 WP_000804320.1.64935 WP_000804320.1.64961 WP_000804320.1.65033 WP_000804320.1.65044 WP_000804320.1.6509 WP_000804320.1.65132 WP_000804320.1.65158 WP_000804320.1.65164 WP_000804320.1.65180 WP_000804320.1.65193 WP_000804320.1.65217 WP_000804320.1.65243 WP_000804320.1.65274 WP_000804320.1.65317 WP_000804320.1.65367 WP_000804320.1.65419 WP_000804320.1.65423 WP_000804320.1.65432 WP_000804320.1.65443 WP_000804320.1.65451 WP_000804320.1.6547 WP_000804320.1.65504 WP_000804320.1.6551 WP_000804320.1.65520 WP_000804320.1.65544 WP_000804320.1.65562 WP_000804320.1.65599 WP_000804320.1.65675 WP_000804320.1.65689 WP_000804320.1.65693 WP_000804320.1.65700 WP_000804320.1.65703 WP_000804320.1.65704 WP_000804320.1.65705 WP_000804320.1.6578 WP_000804320.1.65856 WP_000804320.1.65922 WP_000804320.1.65928 WP_000804320.1.65931 WP_000804320.1.65948 WP_000804320.1.66009 WP_000804320.1.66014 WP_000804320.1.66081 WP_000804320.1.661 WP_000804320.1.66120 WP_000804320.1.66133 WP_000804320.1.66175 WP_000804320.1.66227 WP_000804320.1.66262 WP_000804320.1.66302 WP_000804320.1.66328 WP_000804320.1.66433 WP_000804320.1.66505 WP_000804320.1.66518 WP_000804320.1.66519 WP_000804320.1.66542 WP_000804320.1.66564 WP_000804320.1.66588 WP_000804320.1.66601 WP_000804320.1.66606 WP_000804320.1.6662 WP_000804320.1.66645 WP_000804320.1.66664 WP_000804320.1.66677 WP_000804320.1.6668 WP_000804320.1.66690 WP_000804320.1.66711 WP_000804320.1.6674 WP_000804320.1.66786 WP_000804320.1.66792 WP_000804320.1.66818 WP_000804320.1.6684 WP_000804320.1.66853 WP_000804320.1.66879 WP_000804320.1.66904 WP_000804320.1.66906 WP_000804320.1.67016 WP_000804320.1.67112 WP_000804320.1.67135 WP_000804320.1.67152 WP_000804320.1.67191 WP_000804320.1.6722 WP_000804320.1.67266 WP_000804320.1.67329 WP_000804320.1.67333 WP_000804320.1.67375 WP_000804320.1.67379 WP_000804320.1.6740 WP_000804320.1.67414 WP_000804320.1.67463 WP_000804320.1.67480 WP_000804320.1.67505 WP_000804320.1.67507 WP_000804320.1.67520 WP_000804320.1.67521 WP_000804320.1.67554 WP_000804320.1.67572 WP_000804320.1.67620 WP_000804320.1.67632 WP_000804320.1.67651 WP_000804320.1.67652 WP_000804320.1.67713 WP_000804320.1.67722 WP_000804320.1.67754 WP_000804320.1.67798 WP_000804320.1.67800 WP_000804320.1.67808 WP_000804320.1.67815 WP_000804320.1.6786 WP_000804320.1.67865 WP_000804320.1.67925 WP_000804320.1.67931 WP_000804320.1.67986 WP_000804320.1.68020 WP_000804320.1.68033 WP_000804320.1.68054 WP_000804320.1.68066 WP_000804320.1.6811 WP_000804320.1.68111 WP_000804320.1.68160 WP_000804320.1.68161 WP_000804320.1.68233 WP_000804320.1.68261 WP_000804320.1.68295 WP_000804320.1.68296 WP_000804320.1.6830 WP_000804320.1.68307 WP_000804320.1.68334 WP_000804320.1.6834 WP_000804320.1.68343 WP_000804320.1.68351 WP_000804320.1.68367 WP_000804320.1.68392 WP_000804320.1.68397 WP_000804320.1.68404 WP_000804320.1.68425 WP_000804320.1.68483 WP_000804320.1.68489 WP_000804320.1.68522 WP_000804320.1.68565 WP_000804320.1.68636 WP_000804320.1.68650 WP_000804320.1.68699 WP_000804320.1.68703 WP_000804320.1.68728 WP_000804320.1.68737 WP_000804320.1.68747 WP_000804320.1.68773 WP_000804320.1.68775 WP_000804320.1.68813 WP_000804320.1.68854 WP_000804320.1.68864 WP_000804320.1.68875 WP_000804320.1.68931 WP_000804320.1.68943 WP_000804320.1.68944 WP_000804320.1.69016 WP_000804320.1.69045 WP_000804320.1.69087 WP_000804320.1.69089 WP_000804320.1.691 WP_000804320.1.69147 WP_000804320.1.69162 WP_000804320.1.6917 WP_000804320.1.69191 WP_000804320.1.69219 WP_000804320.1.69222 WP_000804320.1.69237 WP_000804320.1.69366 WP_000804320.1.69395 WP_000804320.1.69412 WP_000804320.1.69415 WP_000804320.1.69476 WP_000804320.1.69483 WP_000804320.1.69489 WP_000804320.1.695 WP_000804320.1.69520 WP_000804320.1.6953 WP_000804320.1.69552 WP_000804320.1.69563 WP_000804320.1.69622 WP_000804320.1.69639 WP_000804320.1.69679 WP_000804320.1.69721 WP_000804320.1.69878 WP_000804320.1.69921 WP_000804320.1.69987 WP_000804320.1.70024 WP_000804320.1.70048 WP_000804320.1.70105 WP_000804320.1.7012 WP_000804320.1.70133 WP_000804320.1.70210 WP_000804320.1.7024 WP_000804320.1.70253 WP_000804320.1.70266 WP_000804320.1.70273 WP_000804320.1.7034 WP_000804320.1.70344 WP_000804320.1.70349 WP_000804320.1.70353 WP_000804320.1.70451 WP_000804320.1.70457 WP_000804320.1.70459 WP_000804320.1.70462 WP_000804320.1.7053 WP_000804320.1.70541 WP_000804320.1.70546 WP_000804320.1.7061 WP_000804320.1.70635 WP_000804320.1.70641 WP_000804320.1.7067 WP_000804320.1.70672 WP_000804320.1.7073 WP_000804320.1.70818 WP_000804320.1.70823 WP_000804320.1.70850 WP_000804320.1.70855 WP_000804320.1.70924 WP_000804320.1.70930 WP_000804320.1.70943 WP_000804320.1.70994 WP_000804320.1.71027 WP_000804320.1.71043 WP_000804320.1.71058 WP_000804320.1.71059 WP_000804320.1.71073 WP_000804320.1.7109 WP_000804320.1.71130 WP_000804320.1.71179 WP_000804320.1.71196 WP_000804320.1.7120 WP_000804320.1.7125 WP_000804320.1.71257 WP_000804320.1.71266 WP_000804320.1.71280 WP_000804320.1.71295 WP_000804320.1.71298 WP_000804320.1.71301 WP_000804320.1.71325 WP_000804320.1.71345 WP_000804320.1.71359 WP_000804320.1.71404 WP_000804320.1.71419 WP_000804320.1.71428 WP_000804320.1.71438 WP_000804320.1.71463 WP_000804320.1.71483 WP_000804320.1.7150 WP_000804320.1.71519 WP_000804320.1.71529 WP_000804320.1.71541 WP_000804320.1.71543 WP_000804320.1.71547 WP_000804320.1.71596 WP_000804320.1.71602 WP_000804320.1.7161 WP_000804320.1.71662 WP_000804320.1.71676 WP_000804320.1.71735 WP_000804320.1.71771 WP_000804320.1.7179 WP_000804320.1.71800 WP_000804320.1.71828 WP_000804320.1.71836 WP_000804320.1.71861 WP_000804320.1.71925 WP_000804320.1.71981 WP_000804320.1.71989 WP_000804320.1.72026 WP_000804320.1.72031 WP_000804320.1.72067 WP_000804320.1.72169 WP_000804320.1.72176 WP_000804320.1.72205 WP_000804320.1.72257 WP_000804320.1.72271 WP_000804320.1.72330 WP_000804320.1.72347 WP_000804320.1.7236 WP_000804320.1.72366 WP_000804320.1.72424 WP_000804320.1.72489 WP_000804320.1.72529 WP_000804320.1.72547 WP_000804320.1.72564 WP_000804320.1.72654 WP_000804320.1.72760 WP_000804320.1.72832 WP_000804320.1.72834 WP_000804320.1.72835 WP_000804320.1.72874 WP_000804320.1.72903 WP_000804320.1.72904 WP_000804320.1.72935 WP_000804320.1.7294 WP_000804320.1.72945 WP_000804320.1.73017 WP_000804320.1.73019 WP_000804320.1.73022 WP_000804320.1.73037 WP_000804320.1.73122 WP_000804320.1.73132 WP_000804320.1.73246 WP_000804320.1.73265 WP_000804320.1.73286 WP_000804320.1.73386 WP_000804320.1.73456 WP_000804320.1.73489 WP_000804320.1.73501 WP_000804320.1.73536 WP_000804320.1.73547 WP_000804320.1.73571 WP_000804320.1.73591 WP_000804320.1.736 WP_000804320.1.73639 WP_000804320.1.73685 WP_000804320.1.73687 WP_000804320.1.73735 WP_000804320.1.73759 WP_000804320.1.73786 WP_000804320.1.7380 WP_000804320.1.73834 WP_000804320.1.73837 WP_000804320.1.73858 WP_000804320.1.73868 WP_000804320.1.73910 WP_000804320.1.73920 WP_000804320.1.73961 WP_000804320.1.73969 WP_000804320.1.73976 WP_000804320.1.73983 WP_000804320.1.74006 WP_000804320.1.74010 WP_000804320.1.74025 WP_000804320.1.74027 WP_000804320.1.74081 WP_000804320.1.74157 WP_000804320.1.74161 WP_000804320.1.74172 WP_000804320.1.74173 WP_000804320.1.74183 WP_000804320.1.74216 WP_000804320.1.74234 WP_000804320.1.74237 WP_000804320.1.7427 WP_000804320.1.7434 WP_000804320.1.74353 WP_000804320.1.74356 WP_000804320.1.74380 WP_000804320.1.74429 WP_000804320.1.74457 WP_000804320.1.7457 WP_000804320.1.74587 WP_000804320.1.74610 WP_000804320.1.74638 WP_000804320.1.74696 WP_000804320.1.74731 WP_000804320.1.74747 WP_000804320.1.74802 WP_000804320.1.74866 WP_000804320.1.74890 WP_000804320.1.74911 WP_000804320.1.74922 WP_000804320.1.74961 WP_000804320.1.74985 WP_000804320.1.74994 WP_000804320.1.74999 WP_000804320.1.75038 WP_000804320.1.75044 WP_000804320.1.75052 WP_000804320.1.75093 WP_000804320.1.75127 WP_000804320.1.75141 WP_000804320.1.75186 WP_000804320.1.75227 WP_000804320.1.75253 WP_000804320.1.75294 WP_000804320.1.75298 WP_000804320.1.75320 WP_000804320.1.75327 WP_000804320.1.75349 WP_000804320.1.75365 WP_000804320.1.75399 WP_000804320.1.7542 WP_000804320.1.75438 WP_000804320.1.75440 WP_000804320.1.75521 WP_000804320.1.75551 WP_000804320.1.75590 WP_000804320.1.7561 WP_000804320.1.75649 WP_000804320.1.75652 WP_000804320.1.75685 WP_000804320.1.75704 WP_000804320.1.75769 WP_000804320.1.758 WP_000804320.1.75805 WP_000804320.1.75830 WP_000804320.1.75848 WP_000804320.1.75881 WP_000804320.1.75885 WP_000804320.1.75929 WP_000804320.1.75944 WP_000804320.1.75952 WP_000804320.1.7596 WP_000804320.1.75969 WP_000804320.1.76010 WP_000804320.1.76015 WP_000804320.1.76095 WP_000804320.1.76104 WP_000804320.1.76123 WP_000804320.1.76143 WP_000804320.1.76230 WP_000804320.1.76234 WP_000804320.1.7624 WP_000804320.1.7625 WP_000804320.1.76258 WP_000804320.1.76261 WP_000804320.1.76282 WP_000804320.1.76283 WP_000804320.1.76332 WP_000804320.1.76337 WP_000804320.1.76351 WP_000804320.1.76419 WP_000804320.1.76420 WP_000804320.1.76421 WP_000804320.1.76482 WP_000804320.1.7658 WP_000804320.1.76606 WP_000804320.1.76624 WP_000804320.1.76648 WP_000804320.1.76659 WP_000804320.1.76686 WP_000804320.1.76689 WP_000804320.1.76690 WP_000804320.1.76693 WP_000804320.1.7675 WP_000804320.1.76790 WP_000804320.1.76792 WP_000804320.1.768 WP_000804320.1.76839 WP_000804320.1.76845 WP_000804320.1.76869 WP_000804320.1.76895 WP_000804320.1.76897 WP_000804320.1.76921 WP_000804320.1.76944 WP_000804320.1.76952 WP_000804320.1.76998 WP_000804320.1.77031 WP_000804320.1.77041 WP_000804320.1.77050 WP_000804320.1.77060 WP_000804320.1.77062 WP_000804320.1.77112 WP_000804320.1.77144 WP_000804320.1.77145 WP_000804320.1.77305 WP_000804320.1.7745 WP_000804320.1.7746 WP_000804320.1.77485 WP_000804320.1.77497 WP_000804320.1.7752 WP_000804320.1.77533 WP_000804320.1.77536 WP_000804320.1.77572 WP_000804320.1.77583 WP_000804320.1.77603 WP_000804320.1.77606 WP_000804320.1.77738 WP_000804320.1.7774 WP_000804320.1.77743 WP_000804320.1.77818 WP_000804320.1.77822 WP_000804320.1.77848 WP_000804320.1.77858 WP_000804320.1.77860 WP_000804320.1.7787 WP_000804320.1.77883 WP_000804320.1.78054 WP_000804320.1.78091 WP_000804320.1.78095 WP_000804320.1.7810 WP_000804320.1.78173 WP_000804320.1.78189 WP_000804320.1.78207 WP_000804320.1.78208 WP_000804320.1.78252 WP_000804320.1.78254 WP_000804320.1.7827 WP_000804320.1.78311 WP_000804320.1.78324 WP_000804320.1.78332 WP_000804320.1.78365 WP_000804320.1.78404 WP_000804320.1.7850 WP_000804320.1.78558 WP_000804320.1.7857 WP_000804320.1.78604 WP_000804320.1.78638 WP_000804320.1.78653 WP_000804320.1.78667 WP_000804320.1.78728 WP_000804320.1.78803 WP_000804320.1.78819 WP_000804320.1.78841 WP_000804320.1.78897 WP_000804320.1.78946 WP_000804320.1.78978 WP_000804320.1.78983 WP_000804320.1.78985 WP_000804320.1.7900 WP_000804320.1.79006 WP_000804320.1.79038 WP_000804320.1.79051 WP_000804320.1.79059 WP_000804320.1.79085 WP_000804320.1.79131 WP_000804320.1.79156 WP_000804320.1.79170 WP_000804320.1.79197 WP_000804320.1.79208 WP_000804320.1.79223 WP_000804320.1.79227 WP_000804320.1.7931 WP_000804320.1.79310 WP_000804320.1.79314 WP_000804320.1.79322 WP_000804320.1.79332 WP_000804320.1.79367 WP_000804320.1.79374 WP_000804320.1.79400 WP_000804320.1.79436 WP_000804320.1.79452 WP_000804320.1.79461 WP_000804320.1.79476 WP_000804320.1.79487 WP_000804320.1.79539 WP_000804320.1.79556 WP_000804320.1.79626 WP_000804320.1.79662 WP_000804320.1.79706 WP_000804320.1.79737 WP_000804320.1.79822 WP_000804320.1.79831 WP_000804320.1.79834 WP_000804320.1.79837 WP_000804320.1.79854 WP_000804320.1.7989 WP_000804320.1.79896 WP_000804320.1.79911 WP_000804320.1.7992 WP_000804320.1.79941 WP_000804320.1.79961 WP_000804320.1.79971 WP_000804320.1.79991 WP_000804320.1.80000 WP_000804320.1.80032 WP_000804320.1.80042 WP_000804320.1.80079 WP_000804320.1.80109 WP_000804320.1.80127 WP_000804320.1.80152 WP_000804320.1.80181 WP_000804320.1.80203 WP_000804320.1.80286 WP_000804320.1.80287 WP_000804320.1.80290 WP_000804320.1.8030 WP_000804320.1.8031 WP_000804320.1.80317 WP_000804320.1.8035 WP_000804320.1.80358 WP_000804320.1.80378 WP_000804320.1.80393 WP_000804320.1.8043 WP_000804320.1.80472 WP_000804320.1.80530 WP_000804320.1.80647 WP_000804320.1.8065 WP_000804320.1.80687 WP_000804320.1.80717 WP_000804320.1.80761 WP_000804320.1.80762 WP_000804320.1.80763 WP_000804320.1.8077 WP_000804320.1.80781 WP_000804320.1.80786 WP_000804320.1.80833 WP_000804320.1.8084 WP_000804320.1.80845 WP_000804320.1.80872 WP_000804320.1.80962 WP_000804320.1.80972 WP_000804320.1.81085 WP_000804320.1.81114 WP_000804320.1.81157 WP_000804320.1.81171 WP_000804320.1.81234 WP_000804320.1.81243 WP_000804320.1.8125 WP_000804320.1.81252 WP_000804320.1.8135 WP_000804320.1.81385 WP_000804320.1.81387 WP_000804320.1.81389 WP_000804320.1.8142 WP_000804320.1.8144 WP_000804320.1.81464 WP_000804320.1.81467 WP_000804320.1.81532 WP_000804320.1.81599 WP_000804320.1.81610 WP_000804320.1.81738 WP_000804320.1.81740 WP_000804320.1.81758 WP_000804320.1.81789 WP_000804320.1.81800 WP_000804320.1.81810 WP_000804320.1.81812 WP_000804320.1.81829 WP_000804320.1.81831 WP_000804320.1.81870 WP_000804320.1.81897 WP_000804320.1.81903 WP_000804320.1.81905 WP_000804320.1.81906 WP_000804320.1.81919 WP_000804320.1.81944 WP_000804320.1.81955 WP_000804320.1.81982 WP_000804320.1.81999 WP_000804320.1.82009 WP_000804320.1.82017 WP_000804320.1.82053 WP_000804320.1.8212 WP_000804320.1.82121 WP_000804320.1.82219 WP_000804320.1.82234 WP_000804320.1.82247 WP_000804320.1.82259 WP_000804320.1.82315 WP_000804320.1.82340 WP_000804320.1.82358 WP_000804320.1.82368 WP_000804320.1.82447 WP_000804320.1.82455 WP_000804320.1.8246 WP_000804320.1.82467 WP_000804320.1.82548 WP_000804320.1.8261 WP_000804320.1.82612 WP_000804320.1.8265 WP_000804320.1.82664 WP_000804320.1.82709 WP_000804320.1.82724 WP_000804320.1.82796 WP_000804320.1.8280 WP_000804320.1.82802 WP_000804320.1.82829 WP_000804320.1.82862 WP_000804320.1.8288 WP_000804320.1.8289 WP_000804320.1.82976 WP_000804320.1.82980 WP_000804320.1.8302 WP_000804320.1.83021 WP_000804320.1.83152 WP_000804320.1.83153 WP_000804320.1.83185 WP_000804320.1.8319 WP_000804320.1.83193 WP_000804320.1.83234 WP_000804320.1.83249 WP_000804320.1.83250 WP_000804320.1.83316 WP_000804320.1.83352 WP_000804320.1.83372 WP_000804320.1.83418 WP_000804320.1.83476 WP_000804320.1.83484 WP_000804320.1.83517 WP_000804320.1.83593 WP_000804320.1.83597 WP_000804320.1.83646 WP_000804320.1.83653 WP_000804320.1.83676 WP_000804320.1.83720 WP_000804320.1.83763 WP_000804320.1.83769 WP_000804320.1.83770 WP_000804320.1.83775 WP_000804320.1.83792 WP_000804320.1.83804 WP_000804320.1.83816 WP_000804320.1.83825 WP_000804320.1.8383 WP_000804320.1.83864 WP_000804320.1.83865 WP_000804320.1.83881 WP_000804320.1.83905 WP_000804320.1.83912 WP_000804320.1.83919 WP_000804320.1.83955 WP_000804320.1.83984 WP_000804320.1.84049 WP_000804320.1.84064 WP_000804320.1.84144 WP_000804320.1.84163 WP_000804320.1.84293 WP_000804320.1.8432 WP_000804320.1.84342 WP_000804320.1.84442 WP_000804320.1.84445 WP_000804320.1.84451 WP_000804320.1.84509 WP_000804320.1.84563 WP_000804320.1.84578 WP_000804320.1.84625 WP_000804320.1.84638 WP_000804320.1.84673 WP_000804320.1.84679 WP_000804320.1.8468 WP_000804320.1.84682 WP_000804320.1.84714 WP_000804320.1.84736 WP_000804320.1.8475 WP_000804320.1.84752 WP_000804320.1.84757 WP_000804320.1.84761 WP_000804320.1.84815 WP_000804320.1.84874 WP_000804320.1.84889 WP_000804320.1.84903 WP_000804320.1.84907 WP_000804320.1.84922 WP_000804320.1.8493 WP_000804320.1.84951 WP_000804320.1.85022 WP_000804320.1.85047 WP_000804320.1.85056 WP_000804320.1.85081 WP_000804320.1.85099 WP_000804320.1.85133 WP_000804320.1.85135 WP_000804320.1.85144 WP_000804320.1.85151 WP_000804320.1.85198 WP_000804320.1.85226 WP_000804320.1.85235 WP_000804320.1.85238 WP_000804320.1.85265 WP_000804320.1.85331 WP_000804320.1.85351 WP_000804320.1.85354 WP_000804320.1.85383 WP_000804320.1.85391 WP_000804320.1.85395 WP_000804320.1.85401 WP_000804320.1.85404 WP_000804320.1.85425 WP_000804320.1.85445 WP_000804320.1.85462 WP_000804320.1.85471 WP_000804320.1.85474 WP_000804320.1.85492 WP_000804320.1.85506 WP_000804320.1.85519 WP_000804320.1.85547 WP_000804320.1.85549 WP_000804320.1.85562 WP_000804320.1.85586 WP_000804320.1.85596 WP_000804320.1.85634 WP_000804320.1.85649 WP_000804320.1.85758 WP_000804320.1.85795 WP_000804320.1.85796 WP_000804320.1.85816 WP_000804320.1.85834 WP_000804320.1.85927 WP_000804320.1.85950 WP_000804320.1.85989 WP_000804320.1.85993 WP_000804320.1.86018 WP_000804320.1.86072 WP_000804320.1.86123 WP_000804320.1.86136 WP_000804320.1.86144 WP_000804320.1.86153 WP_000804320.1.86154 WP_000804320.1.86158 WP_000804320.1.86188 WP_000804320.1.86197 WP_000804320.1.86207 WP_000804320.1.8627 WP_000804320.1.86270 WP_000804320.1.86331 WP_000804320.1.86344 WP_000804320.1.86367 WP_000804320.1.86378 WP_000804320.1.8641 WP_000804320.1.8643 WP_000804320.1.86439 WP_000804320.1.86455 WP_000804320.1.86482 WP_000804320.1.86523 WP_000804320.1.86542 WP_000804320.1.86628 WP_000804320.1.8663 WP_000804320.1.86706 WP_000804320.1.86792 WP_000804320.1.8681 WP_000804320.1.86838 WP_000804320.1.86911 WP_000804320.1.86916 WP_000804320.1.86940 WP_000804320.1.86942 WP_000804320.1.86961 WP_000804320.1.86977 WP_000804320.1.87021 WP_000804320.1.87042 WP_000804320.1.87057 WP_000804320.1.87072 WP_000804320.1.87090 WP_000804320.1.87119 WP_000804320.1.8712 WP_000804320.1.87122 WP_000804320.1.87141 WP_000804320.1.87175 WP_000804320.1.87194 WP_000804320.1.8720 WP_000804320.1.87236 WP_000804320.1.87260 WP_000804320.1.87261 WP_000804320.1.87285 WP_000804320.1.87290 WP_000804320.1.8731 WP_000804320.1.87396 WP_000804320.1.87457 WP_000804320.1.87461 WP_000804320.1.87466 WP_000804320.1.875 WP_000804320.1.87508 WP_000804320.1.87515 WP_000804320.1.8753 WP_000804320.1.87534 WP_000804320.1.87543 WP_000804320.1.87593 WP_000804320.1.87636 WP_000804320.1.87682 WP_000804320.1.8770 WP_000804320.1.87710 WP_000804320.1.87718 WP_000804320.1.87748 WP_000804320.1.87764 WP_000804320.1.8779 WP_000804320.1.87808 WP_000804320.1.87828 WP_000804320.1.87838 WP_000804320.1.87879 WP_000804320.1.8791 WP_000804320.1.87912 WP_000804320.1.87963 WP_000804320.1.87964 WP_000804320.1.87972 WP_000804320.1.87995 WP_000804320.1.88013 WP_000804320.1.88032 WP_000804320.1.88061 WP_000804320.1.88114 WP_000804320.1.88150 WP_000804320.1.88212 WP_000804320.1.88270 WP_000804320.1.88317 WP_000804320.1.88319 WP_000804320.1.88339 WP_000804320.1.88351 WP_000804320.1.88367 WP_000804320.1.88371 WP_000804320.1.88380 WP_000804320.1.88445 WP_000804320.1.88480 WP_000804320.1.88498 WP_000804320.1.88504 WP_000804320.1.88518 WP_000804320.1.88555 WP_000804320.1.88558 WP_000804320.1.8857 WP_000804320.1.88572 WP_000804320.1.88580 WP_000804320.1.88599 WP_000804320.1.88623 WP_000804320.1.88636 WP_000804320.1.88638 WP_000804320.1.88642 WP_000804320.1.88671 WP_000804320.1.88694 WP_000804320.1.8872 WP_000804320.1.88739 WP_000804320.1.8877 WP_000804320.1.88856 WP_000804320.1.88859 WP_000804320.1.8886 WP_000804320.1.8888 WP_000804320.1.88881 WP_000804320.1.88897 WP_000804320.1.88922 WP_000804320.1.88934 WP_000804320.1.8899 WP_000804320.1.8900 WP_000804320.1.89027 WP_000804320.1.89086 WP_000804320.1.89108 WP_000804320.1.8913 WP_000804320.1.89133 WP_000804320.1.89139 WP_000804320.1.89181 WP_000804320.1.89194 WP_000804320.1.89195 WP_000804320.1.89204 WP_000804320.1.89216 WP_000804320.1.8924 WP_000804320.1.89258 WP_000804320.1.89284 WP_000804320.1.89372 WP_000804320.1.89476 WP_000804320.1.8950 WP_000804320.1.89537 WP_000804320.1.89544 WP_000804320.1.89545 WP_000804320.1.89556 WP_000804320.1.89557 WP_000804320.1.89559 WP_000804320.1.89603 WP_000804320.1.89655 WP_000804320.1.89672 WP_000804320.1.89678 WP_000804320.1.89686 WP_000804320.1.897 WP_000804320.1.89726 WP_000804320.1.89730 WP_000804320.1.89754 WP_000804320.1.89799 WP_000804320.1.89857 WP_000804320.1.89883 WP_000804320.1.89924 WP_000804320.1.89935 WP_000804320.1.89960 WP_000804320.1.90018 WP_000804320.1.90038 WP_000804320.1.90046 WP_000804320.1.90055 WP_000804320.1.90095 WP_000804320.1.90131 WP_000804320.1.90145 WP_000804320.1.90148 WP_000804320.1.90161 WP_000804320.1.90180 WP_000804320.1.90215 WP_000804320.1.9022 WP_000804320.1.90243 WP_000804320.1.90253 WP_000804320.1.90276 WP_000804320.1.9030 WP_000804320.1.90331 WP_000804320.1.90345 WP_000804320.1.90367 WP_000804320.1.90370 WP_000804320.1.90473 WP_000804320.1.90544 WP_000804320.1.90554 WP_000804320.1.90604 WP_000804320.1.90647 WP_000804320.1.90660 WP_000804320.1.90683 WP_000804320.1.90728 WP_000804320.1.90738 WP_000804320.1.90740 WP_000804320.1.90745 WP_000804320.1.90757 WP_000804320.1.90801 WP_000804320.1.90804 WP_000804320.1.90818 WP_000804320.1.90820 WP_000804320.1.90861 WP_000804320.1.90896 WP_000804320.1.90903 WP_000804320.1.9100 WP_000804320.1.91011 WP_000804320.1.91054 WP_000804320.1.91124 WP_000804320.1.91126 WP_000804320.1.9114 WP_000804320.1.91158 WP_000804320.1.91177 WP_000804320.1.912 WP_000804320.1.91233 WP_000804320.1.91246 WP_000804320.1.91258 WP_000804320.1.91279 WP_000804320.1.91297 WP_000804320.1.91300 WP_000804320.1.91332 WP_000804320.1.91346 WP_000804320.1.91357 WP_000804320.1.91364 WP_000804320.1.91382 WP_000804320.1.9140 WP_000804320.1.91420 WP_000804320.1.91427 WP_000804320.1.91487 WP_000804320.1.91500 WP_000804320.1.9153 WP_000804320.1.91559 WP_000804320.1.91573 WP_000804320.1.91581 WP_000804320.1.91587 WP_000804320.1.91624 WP_000804320.1.91639 WP_000804320.1.91660 WP_000804320.1.91746 WP_000804320.1.91749 WP_000804320.1.91771 WP_000804320.1.91791 WP_000804320.1.91800 WP_000804320.1.91816 WP_000804320.1.91829 WP_000804320.1.91895 WP_000804320.1.91909 WP_000804320.1.91919 WP_000804320.1.91928 WP_000804320.1.91950 WP_000804320.1.92 WP_000804320.1.92080 WP_000804320.1.92133 WP_000804320.1.92140 WP_000804320.1.92143 WP_000804320.1.92147 WP_000804320.1.92164 WP_000804320.1.92169 WP_000804320.1.92173 WP_000804320.1.92185 WP_000804320.1.92196 WP_000804320.1.92227 WP_000804320.1.9224 WP_000804320.1.92253 WP_000804320.1.92254 WP_000804320.1.923 WP_000804320.1.9234 WP_000804320.1.9237 WP_000804320.1.9239 WP_000804320.1.92436 WP_000804320.1.92442 WP_000804320.1.92488 WP_000804320.1.92497 WP_000804320.1.92500 WP_000804320.1.92520 WP_000804320.1.92534 WP_000804320.1.92546 WP_000804320.1.92565 WP_000804320.1.92607 WP_000804320.1.92679 WP_000804320.1.92688 WP_000804320.1.92691 WP_000804320.1.92723 WP_000804320.1.92735 WP_000804320.1.92741 WP_000804320.1.92773 WP_000804320.1.92789 WP_000804320.1.92805 WP_000804320.1.92862 WP_000804320.1.92864 WP_000804320.1.9293 WP_000804320.1.92937 WP_000804320.1.92950 WP_000804320.1.9305 WP_000804320.1.93074 WP_000804320.1.93125 WP_000804320.1.93163 WP_000804320.1.93176 WP_000804320.1.93191 WP_000804320.1.93198 WP_000804320.1.93211 WP_000804320.1.93224 WP_000804320.1.93263 WP_000804320.1.93296 WP_000804320.1.9330 WP_000804320.1.93300 WP_000804320.1.93336 WP_000804320.1.93374 WP_000804320.1.93416 WP_000804320.1.93438 WP_000804320.1.93444 WP_000804320.1.93514 WP_000804320.1.9352 WP_000804320.1.93538 WP_000804320.1.9354 WP_000804320.1.9358 WP_000804320.1.93590 WP_000804320.1.93647 WP_000804320.1.93658 WP_000804320.1.93669 WP_000804320.1.93678 WP_000804320.1.93710 WP_000804320.1.93722 WP_000804320.1.93738 WP_000804320.1.93769 WP_000804320.1.93787 WP_000804320.1.9387 WP_000804320.1.93882 WP_000804320.1.93883 WP_000804320.1.93891 WP_000804320.1.93975 WP_000804320.1.93976 WP_000804320.1.9398 WP_000804320.1.94074 WP_000804320.1.94082 WP_000804320.1.94087 WP_000804320.1.94093 WP_000804320.1.94096 WP_000804320.1.94119 WP_000804320.1.94165 WP_000804320.1.94172 WP_000804320.1.94182 WP_000804320.1.94229 WP_000804320.1.94293 WP_000804320.1.94294 WP_000804320.1.94335 WP_000804320.1.94340 WP_000804320.1.9437 WP_000804320.1.94375 WP_000804320.1.94376 WP_000804320.1.94389 WP_000804320.1.94407 WP_000804320.1.94414 WP_000804320.1.94530 WP_000804320.1.94550 WP_000804320.1.94576 WP_000804320.1.94625 WP_000804320.1.9464 WP_000804320.1.94688 WP_000804320.1.94719 WP_000804320.1.94733 WP_000804320.1.94741 WP_000804320.1.94789 WP_000804320.1.94797 WP_000804320.1.94838 WP_000804320.1.94844 WP_000804320.1.94845 WP_000804320.1.9485 WP_000804320.1.94857 WP_000804320.1.94866 WP_000804320.1.9497 WP_000804320.1.94980 WP_000804320.1.94989 WP_000804320.1.94999 WP_000804320.1.95002 WP_000804320.1.95038 WP_000804320.1.95075 WP_000804320.1.95077 WP_000804320.1.9510 WP_000804320.1.95120 WP_000804320.1.95210 WP_000804320.1.95318 WP_000804320.1.95327 WP_000804320.1.95342 WP_000804320.1.95361 WP_000804320.1.95372 WP_000804320.1.9538 WP_000804320.1.95442 WP_000804320.1.95535 WP_000804320.1.95537 WP_000804320.1.95550 WP_000804320.1.95552 WP_000804320.1.95581 WP_000804320.1.95603 WP_000804320.1.95631 WP_000804320.1.95639 WP_000804320.1.95640 WP_000804320.1.95681 WP_000804320.1.95699 WP_000804320.1.95704 WP_000804320.1.95713 WP_000804320.1.95714 WP_000804320.1.95737 WP_000804320.1.95760 WP_000804320.1.95806 WP_000804320.1.95877 WP_000804320.1.95885 WP_000804320.1.95914 WP_000804320.1.95918 WP_000804320.1.95986 WP_000804320.1.95997 WP_000804320.1.96014 WP_000804320.1.96030 WP_000804320.1.96056 WP_000804320.1.96057 WP_000804320.1.96067 WP_000804320.1.96075 WP_000804320.1.96105 WP_000804320.1.96135 WP_000804320.1.96148 WP_000804320.1.96165 WP_000804320.1.9617 WP_000804320.1.96228 WP_000804320.1.96255 WP_000804320.1.96283 WP_000804320.1.96297 WP_000804320.1.96312 WP_000804320.1.96314 WP_000804320.1.96322 WP_000804320.1.96334 WP_000804320.1.96362 WP_000804320.1.96364 WP_000804320.1.96424 WP_000804320.1.96433 WP_000804320.1.96472 WP_000804320.1.96477 WP_000804320.1.96489 WP_000804320.1.9650 WP_000804320.1.96535 WP_000804320.1.96538 WP_000804320.1.96554 WP_000804320.1.96566 WP_000804320.1.96578 WP_000804320.1.96591 WP_000804320.1.96603 WP_000804320.1.96637 WP_000804320.1.96638 WP_000804320.1.96654 WP_000804320.1.96678 WP_000804320.1.96699 WP_000804320.1.96705 WP_000804320.1.96718 WP_000804320.1.9675 WP_000804320.1.96780 WP_000804320.1.96836 WP_000804320.1.96855 WP_000804320.1.96859 WP_000804320.1.96892 WP_000804320.1.96922 WP_000804320.1.96956 WP_000804320.1.96965 WP_000804320.1.96969 WP_000804320.1.96985 WP_000804320.1.96997 WP_000804320.1.97000 WP_000804320.1.97014 WP_000804320.1.97017 WP_000804320.1.97029 WP_000804320.1.97033 WP_000804320.1.97034 WP_000804320.1.97139 WP_000804320.1.97141 WP_000804320.1.97146 WP_000804320.1.97161 WP_000804320.1.97164 WP_000804320.1.97205 WP_000804320.1.97228 WP_000804320.1.97230 WP_000804320.1.97241 WP_000804320.1.97302 WP_000804320.1.97336 WP_000804320.1.97348 WP_000804320.1.97352 WP_000804320.1.97355 WP_000804320.1.97367 WP_000804320.1.9737 WP_000804320.1.97392 WP_000804320.1.97409 WP_000804320.1.97427 WP_000804320.1.9743 WP_000804320.1.97450 WP_000804320.1.97456 WP_000804320.1.97460 WP_000804320.1.9748 WP_000804320.1.97494 WP_000804320.1.97530 WP_000804320.1.97531 WP_000804320.1.97537 WP_000804320.1.97575 WP_000804320.1.97576 WP_000804320.1.9758 WP_000804320.1.97585 WP_000804320.1.97641 WP_000804320.1.97664 WP_000804320.1.97687 WP_000804320.1.97696 WP_000804320.1.97699 WP_000804320.1.97742 WP_000804320.1.97744 WP_000804320.1.97746 WP_000804320.1.97762 WP_000804320.1.9788 WP_000804320.1.97935 WP_000804320.1.97953 WP_000804320.1.97955 WP_000804320.1.97967 WP_000804320.1.97974 WP_000804320.1.97997 WP_000804320.1.98054 WP_000804320.1.98058 WP_000804320.1.98073 WP_000804320.1.98161 WP_000804320.1.98174 WP_000804320.1.98179 WP_000804320.1.98195 WP_000804320.1.98233 WP_000804320.1.98248 WP_000804320.1.98249 WP_000804320.1.98281 WP_000804320.1.98295 WP_000804320.1.98328 WP_000804320.1.98352 WP_000804320.1.98353 WP_000804320.1.98366 WP_000804320.1.98387 WP_000804320.1.98409 WP_000804320.1.98415 WP_000804320.1.98425 WP_000804320.1.98548 WP_000804320.1.98559 WP_000804320.1.98585 WP_000804320.1.98609 WP_000804320.1.98659 WP_000804320.1.98667 WP_000804320.1.98710 WP_000804320.1.9872 WP_000804320.1.98723 WP_000804320.1.98730 WP_000804320.1.98734 WP_000804320.1.98741 WP_000804320.1.98750 WP_000804320.1.98786 WP_000804320.1.98797 WP_000804320.1.98805 WP_000804320.1.98807 WP_000804320.1.98821 WP_000804320.1.98842 WP_000804320.1.98880 WP_000804320.1.98894 WP_000804320.1.98912 WP_000804320.1.98978 WP_000804320.1.98981 WP_000804320.1.98985 WP_000804320.1.99027 WP_000804320.1.99081 WP_000804320.1.991 WP_000804320.1.9910 WP_000804320.1.99136 WP_000804320.1.99174 WP_000804320.1.99207 WP_000804320.1.99217 WP_000804320.1.99228 WP_000804320.1.99283 WP_000804320.1.99308 WP_000804320.1.99311 WP_000804320.1.99331 WP_000804320.1.99414 WP_000804320.1.99418 WP_000804320.1.99509 WP_000804320.1.99523 WP_000804320.1.9965 WP_000804320.1.99683 WP_000804320.1.9974 WP_000804320.1.99830 WP_000804320.1.99849 WP_000804320.1.99859 WP_000804320.1.99884 WP_000804320.1.99954 WP_000804320.1.99955 WP_000804320.1.99984 WP_000804320.1.99999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]