SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1VNA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1VNA1
Domain Number 1 Region: 119-220
Classification Level Classification E-value
Superfamily Homing endonucleases 5.33e-18
Family Intein endonuclease 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E1VNA1
Sequence length 314
Comment (tr|A0A0E1VNA1|A0A0E1VNA1_STAEP) Putative sporulation transcription regulator WhiA {ECO:0000256|HAMAP-Rule:MF_01420, ECO:0000256|SAAS:SAAS00981672} KW=Complete proteome OX=525376 OS=Staphylococcus epidermidis W23144. GN=HMPREF0791_0663 OC=Staphylococcus.
Sequence
MSFASDMKNELTRIEVDESNAKAELSALIRMNGALSLSNQQFVINVQTENATTARRIYSL
IKRIFNVEVEILVRKKMKLKKNNIYICRTKMLAKEILNDLGILKEGVFTHDIDPDMIKDD
EMKRSYLRGAFLAGGSVNNPETSSYHLEIFSQYEDHSEGLTKLMNSYELNAKHLERKKGS
IAYLKEAEKISDFLSLIGGYQALLKFEDVRIVRDMRNSVNRLVNCETANLNKTVSAAMKQ
VESIQLIDEEIGLENLPDRLREVAKLRVEHQEISLKELGEMVSTGPISKSGMNHRLRKLN
ELADKIRNGEQIEL
Download sequence
Identical sequences A0A0E1VNA1 A0A0U5QZ55 A0A1J4HBG2
WP_002445957.1.101221 WP_002445957.1.101434 WP_002445957.1.10433 WP_002445957.1.1064 WP_002445957.1.21138 WP_002445957.1.27481 WP_002445957.1.29011 WP_002445957.1.37086 WP_002445957.1.37090 WP_002445957.1.62068 WP_002445957.1.64580 WP_002445957.1.66648 WP_002445957.1.68882 WP_002445957.1.7614 WP_002445957.1.79440 WP_002445957.1.90286 WP_002445957.1.94891 WP_002445957.1.98274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]