SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1Z8T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1Z8T7
Domain Number - Region: 26-166
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0602
Family Hemolysin E (HlyE, ClyA, SheA) 0.069
Further Details:      
 
Domain Number - Region: 139-192
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.085
Family Occludin/ELL domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1Z8T7
Sequence length 195
Comment (tr|A0A0E1Z8T7|A0A0E1Z8T7_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EHO08600.1} KW=Complete proteome OX=883150 OS=Myroides odoratimimus CCUG 10230. GN=HMPREF9712_02262 OC=Flavobacteriaceae; Myroides.
Sequence
MRNKFTFTVALIAISLASFAQERTNTIDNQFNTLLNESTNWQKSKIVEVEKLHQLQKNVN
DSLTKLHLTIANNKDASLEHKESVESLTSQLQITRDSLSTSLTTTKNIEVLGISSEKSTF
LTIIWAIIGILIIVLGIIYYRFKRSFSEIREVNRKLSETEEELEELRKSSLEREQRIRRQ
LQDEINKNKPVEKKE
Download sequence
Identical sequences A0A0E1Z8T7 A0A0S7E670 H1H614
WP_006259091.1.13172 WP_006259091.1.17645 WP_006259091.1.24692 WP_006259091.1.29191 WP_006259091.1.46351 WP_006259091.1.65817 WP_006259091.1.86079 WP_006259091.1.93699 WP_006259091.1.99851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]