SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E1ZJ23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1ZJ23
Domain Number 1 Region: 331-456
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000194
Family Glutathione peroxidase-like 0.038
Further Details:      
 
Weak hits

Sequence:  A0A0E1ZJ23
Domain Number - Region: 42-78
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0837
Family Capz alpha-1 subunit 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1ZJ23
Sequence length 469
Comment (tr|A0A0E1ZJ23|A0A0E1ZJ23_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EHO09838.1} KW=Complete proteome OX=883150 OS=Myroides odoratimimus CCUG 10230. GN=HMPREF9712_01615 OC=Flavobacteriaceae; Myroides.
Sequence
MQKKLPNTNLLLLFIPLISLLASCQKKFDPKDYSAYIQGEIINPTSNYLLFCKDNEVLDT
LFLDENNKFYKKFDSLTPGMYIYKHNPEFQYIYFDKNDSLTLRLNSRDFDHSIIFSGRGA
EKNNFLMNLTVRNIMDESEGYSAFDVSPEKFSRRIDSVHAARTTYYLRNKAIINWSDNFD
LYAKAKLDLHFFALKELYPTAHYVRTDEDVRDKLPADYYSFRKKINFNDERLLKYSSFTK
YLAIMLNSIVNEPEQNIIPDNKFDKYIDKLNIVDTLIRNDKVKNAILDNIAFIYLLEDQN
LNNNDKFLERYFELSTDKNQHNEIIQIQQAIQNLKYEKKLPEVPIVNTKNQKVSINSIIN
KRTLMFFWTKNGIAHADAAHQIAAELKAEMPNIEIISICIDGEHGEWLSILKRYPSNGII
ELRSDDFNQMKDQWIITKIQRCMLLDKDGSIIDPFVNIFDKNFETILKQ
Download sequence
Identical sequences A0A0E1ZJ23 A0A0U3GZM7
WP_006258396.1.24692 WP_006258396.1.46351 WP_006258396.1.65817 WP_006258396.1.93699 WP_006258396.1.99851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]