SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E1ZNQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1ZNQ5
Domain Number 1 Region: 794-1182
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.18e-122
Family PFOR PP module 0.00000000778
Further Details:      
 
Domain Number 2 Region: 416-662
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-79
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000017
Further Details:      
 
Domain Number 3 Region: 5-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.28e-75
Family PFOR Pyr module 0.0000000242
Further Details:      
 
Domain Number 4 Region: 259-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.89e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000188
Further Details:      
 
Domain Number 5 Region: 671-837
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.37e-18
Family Ferredoxin domains from multidomain proteins 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E1ZNQ5
Sequence length 1186
Comment (tr|A0A0E1ZNQ5|A0A0E1ZNQ5_CAMJU) Pyruvate-flavodoxin oxidoreductase {ECO:0000256|PIRNR:PIRNR000159} KW=Complete proteome OX=889253 OS=Campylobacter jejuni subsp. jejuni 2008-988. GN=cje154_04609 OC=Campylobacteraceae; Campylobacter.
Sequence
MGKIMKTMDGNEAAAYAAYAFTEVAGIYPITPSSPMADYTDMWAAAGKKNLFGVPVKIVE
MQSEAGAAGSVHGSLQAGALTTTYTASQGLLLKIPNMYKIAGQLLPCVIHVAARSLAAQA
LSIFGDHQDIYAARQIGFAMLCSHSVQETMDLAGVAHLAAIKGRVPFLHFFDGFRTSHEI
QKVEVMDYAHFDRLLDREALLEFRNNALNPENPKTRGTAQNDDIYFQTREVSNRFYNALP
DVVNEYMQEISKITGREYKPFTYYGHKEPECVIVAMGSVTQALEEVVDYLNAKGEKVGIL
KVYLYRPFSLKYFFDVMPKSVKKIAVLDRTKEPGSLGEPLYLDVKSAFYGRENAPVIVGG
RYGLSSKDVDPAQMIAVFENLKLDNPKDGFTVGIIDDVTHTSLSTGEKISLGDESTIECL
FYGLGADGTVGANKNSIKIIGDKTDFYAQAYFAYDSKKSGGYTRSHLRFSKKPIRSTYLV
STPHFIACSVAAYLEIYDVLAGIRKGGTFLLNSIWNAEETIRQLPDAVKKTLAEKEVNFY
IINATKLARDIGLGNRTNTIMQSAFFKLAKIIPYEDAQKYMKELAYKSYSKKGDAIVEMN
YKAIDVGADGLVKVEVDPNWKNLELKEKEQTNAYKGTEFVEKIVKPMNAAKGDDLPVSAF
LGYEDGSFEHGTTEYEKRGVGVMVPRWIEANCIQCNQCASVCPHAVIRPFLINDEEMANA
PRGVKDHALEAKGTKGEKLSFKIQVSPLDCTGCELCVHECPTKEKSLVMVPLQEEMDFGE
QENADYLFKEITYKDDILNKEATKGAQFAQPLFEFHGACPGCGETPYITLITRLFGERMI
VANATGCSSIYGGSAPSTPYRKSVKNGHGPAWGNSLFEDNAEFGLGMKIATENTRHRIEH
IMNESMQEVPNALSALFKDWIANKDNGAMSVEIKDKMIPILEQNKNIKAVQDILELKQYL
SKKSHWIFGGDGWAYDIGYGGLDHVLASGENVNILVLDTEVYSNTGGQSSKSSRTGAVAQ
FAAAGKPIQKKDLGQIAMTYGYIFVAQVNSTANYTHLIKAITAAEAYNGPSLVICYSPCI
AHGIKGGLGYSGEQGELATKCGYWPLYTFDPRLEEQGKNPLTLTGKEPDWDLYEQFLMNE
VRYNSLKKANPEHAAELFERNKKDAQRRYRQLKRIAMADYSNEVES
Download sequence
Identical sequences A0A0E1ZNQ5
WP_002871858.1.100358 WP_002871858.1.101346 WP_002871858.1.101807 WP_002871858.1.10462 WP_002871858.1.11336 WP_002871858.1.17462 WP_002871858.1.18219 WP_002871858.1.19381 WP_002871858.1.21512 WP_002871858.1.24675 WP_002871858.1.35241 WP_002871858.1.35952 WP_002871858.1.39743 WP_002871858.1.41421 WP_002871858.1.41766 WP_002871858.1.44298 WP_002871858.1.45438 WP_002871858.1.48021 WP_002871858.1.48314 WP_002871858.1.50385 WP_002871858.1.54092 WP_002871858.1.55476 WP_002871858.1.5843 WP_002871858.1.60531 WP_002871858.1.61249 WP_002871858.1.61383 WP_002871858.1.62451 WP_002871858.1.62457 WP_002871858.1.6402 WP_002871858.1.65644 WP_002871858.1.67138 WP_002871858.1.7176 WP_002871858.1.75460 WP_002871858.1.7643 WP_002871858.1.77828 WP_002871858.1.78406 WP_002871858.1.78999 WP_002871858.1.79613 WP_002871858.1.84246 WP_002871858.1.88403 WP_002871858.1.88784 WP_002871858.1.88833 WP_002871858.1.90277 WP_002871858.1.90347 WP_002871858.1.91753 WP_002871858.1.92449 WP_002871858.1.93029 WP_002871858.1.93549 WP_002871858.1.9591 WP_002871858.1.96302 WP_002871858.1.96525 WP_002871858.1.96886 WP_002871858.1.99444 WP_002871858.1.99811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]