SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2BKK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2BKK6
Domain Number - Region: 9-52
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00798
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2BKK6
Sequence length 82
Comment (tr|A0A0E2BKK6|A0A0E2BKK6_9LEPT) Uncharacterized protein {ECO:0000313|EMBL:EKO35730.1} KW=Complete proteome OX=1049984 OS=Leptospira santarosai str. MOR084. GN=LEP1GSC179_2804 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MKKDFLKKFGHFSELDSQFIAYPIYENKGIDFRFKRLYQMEWKVIKEKRLGRLLPPYINK
LQQKYSSYLQRQGLPRLPNLRF
Download sequence
Identical sequences A0A0E2BKK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]