SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E2D4G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2D4G4
Domain Number 1 Region: 161-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.96e-69
Family Methylesterase CheB, C-terminal domain 0.0000005
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily CheY-like 6.97e-26
Family CheY-related 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E2D4G4
Sequence length 347
Comment (tr|A0A0E2D4G4|A0A0E2D4G4_LEPIR) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1049938 OS=Leptospira interrogans str. UI 12758. GN=LEP1GSC105_1397 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MIQVFIVDDSAVVRQALTQILNKDPEIEIIGFASDPIFASEKLSSVWPDVFILDIEMPRM
DGISFLKKIMSEKPTPVIICSSLAEKESETAVLAMKLGAVDIIEKPKVGLKNFLEESEIL
FIDSVRAASNARVKTHSFQNDDSKFFENHKQPKTDFSKIDTTDKLIAIGTSTGGTQALEF
ILTQLNIHCPGIVIVQHMPEKFTEAFANRLNQVCKIQVKEAKDGDRVQLGSAYIAPGNKH
MEIYLSGAQFHIRVLDGPLVNRHRPSVDTLFHSVAKAAGKNAKGIIMTGMGNDGANGLLK
MKQSGAHTIAQDEASCVVFGMPKEAILKGAVNTILPLSKIVGEVQYF
Download sequence
Identical sequences A0A0E2D4G4
WP_000616850.1.51443 WP_000616850.1.78739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]