SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E2DLL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2DLL1
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.03e-50
Family Methylesterase CheB, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2DLL1
Sequence length 176
Comment (tr|A0A0E2DLL1|A0A0E2DLL1_LEPIR) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=1049938 OS=Leptospira interrogans str. UI 12758. GN=LEP1GSC105_4324 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MKTILPTLPTQFGIPIVIVQHIGARSDGEWFRILEKLCNIKIKEAEEKEEIKSGMVYVAP
PNYHLLIEKDKTFSFSIGERVNFSRPSIDVLFETASEVYEDKLIGVILTGANSDGAQGLK
KIKENGGLAVVQDPLTAEIALMPRSAIEATSVDYVLSLEKIAELFIRLDQNNLEQR
Download sequence
Identical sequences A0A0E2DLL1 A0A0F6HG06 A0A0F6HVA4 A0A0F6IEN3 A0A0M4N8B2 N1UNQ5
NP_711925.2.97817 gi|386073877|ref|YP_005988194.1| gi|294827939|ref|NP_711925.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]