SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2E3S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2E3S7
Domain Number 1 Region: 17-126
Classification Level Classification E-value
Superfamily FlgN-like 0.00000811
Family FlgN-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E2E3S7
Sequence length 157
Comment (tr|A0A0E2E3S7|A0A0E2E3S7_TREDN) Uncharacterized protein {ECO:0000313|EMBL:EMB33187.1} KW=Complete proteome OX=999432 OS=Treponema denticola H-22. GN=HMPREF9726_01548 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MKQVLSRQEIDQRVAVLKRFKALLQEQRKKFSDYLVVLETQERSIHEENIDALVHHTELE
QSIIGDIFTIQKVIDPIEEMYRLGMPDKDDTEVVRLKSDLNKLQSQVIDQNQKNRELLQS
RMADLRQEMISIKPDYRYSKQALSKQEISASLVDISI
Download sequence
Identical sequences A0A0E2E3S7 E9S115
WP_002666706.1.67935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]