SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2E701 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2E701
Domain Number - Region: 197-294
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.000111
Family V-type ATPase subunit E 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2E701
Sequence length 308
Comment (tr|A0A0E2E701|A0A0E2E701_TREDN) Uncharacterized protein {ECO:0000313|EMBL:EMB35831.1} KW=Complete proteome OX=999432 OS=Treponema denticola H-22. GN=HMPREF9726_00023 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MAKTIFRGFEVNKNNNDVVFLQLNKTFQEEPEEIIEEKVPVYEGPTVEDLKKEAEDFKLE
WEKQKEKMISDAKAEADKIIEDAQNAAFDEVKRQTDEAQVIAQNAKKDAEDIIAEAEQKA
RDIIADSEKNKDSVNRDAYKEGFNRGREEGFKEGNLEVQRLTDRLHTIINKTMDRRQEIL
SETEQQIVDLVLLMTRKVVKVISENQRNVVVSNVVHALRKVKGRGDVVIRVNLADVKMTT
EHIQNFISAAENIKNITVVEDSTVDQGGCIIETDFGAVDARIASQLNELEQKILEISPIK
TKIKTGNI
Download sequence
Identical sequences A0A0E2E701 A0A0E2EE11 E9S3X2 M2CIG7 M2RPK2 Q73ND8
243275.TDE1217 gi|42526726|ref|NP_971824.1| NP_971824.1.36654 WP_002668471.1.18616 WP_002668471.1.22144 WP_002668471.1.67935 WP_002668471.1.74579 WP_002668471.1.77811 WP_002668471.1.77933 WP_002668471.1.94299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]