SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E2EI86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2EI86
Domain Number 1 Region: 787-936,970-1197
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.46e-126
Family PFOR PP module 0.00000000756
Further Details:      
 
Domain Number 2 Region: 415-658
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.06e-87
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000908
Further Details:      
 
Domain Number 3 Region: 3-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.32e-73
Family PFOR Pyr module 0.0000000184
Further Details:      
 
Domain Number 4 Region: 260-413
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.86e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000103
Further Details:      
 
Domain Number 5 Region: 671-766
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.16e-16
Family Ferredoxin domains from multidomain proteins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2EI86
Sequence length 1201
Comment (tr|A0A0E2EI86|A0A0E2EI86_TREDN) Pyruvate-flavodoxin oxidoreductase {ECO:0000256|PIRNR:PIRNR000159} KW=Complete proteome OX=999432 OS=Treponema denticola H-22. GN=HMPREF9726_00902 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MQKKTQTMTGNNAASYVAYAFTDVAAIYPITPSSDMAELVDSWAANGRKNIFGQTVLVSE
LESEAGAAGSMHGALSAGALASSFTASQGLLLMIPNMYKMSGELLPGVLHVSARALSAHA
LSIFGDHQDVMACRQTGFGMLASGSVQEIIDLGGIAHLAAIKGRVPFLHFFDGFRTSHEL
QNVELIEYEDFAKMLDWKALNDWRTTAMNPEHPFTKGTAQNPDVYFQAAEASNKFYTDVV
EIVADYMKQISALTGRTYRPFDYHGAPDAERVIIAMGSITETAEETVDYLVSKGEKVGLI
KVRLYRPFSPKYLFDVMPKTVKKIAVLDRTKEKGALYEPLHLDILGAYIDVPNKPLIVGG
RYGLASKDTTPSMVKSVFDNLKADAPKNNFTVGIEDDITNLSLPVLEEIKTEPAGTIRCK
FWGFGSDGTVGANKSAIKIIGDSTGMYAQAYFAYDSKKSGGVTISHLRFGKQPIKSTYLI
SDADFISCSKQSYVHQYDLLKGLKKGGTFLLNCLWSDEELEANLPGEMKRFIAKNEIKFY
TINATGIAQEIGLGGRINMIMQSAFFKLAEIIPIEEAVDSLKKSIVRDYGKKGEDIVNMN
YAAVEKGVNSLHKVAVPAAWANAEDSKICNSHLPPYVRNVLIPINRQEGDALKVSTFKGV
EDGRMPNCTSRYEKRGVAVEVPHWIKENCIQCNQCSFVCPHATIRPFLLNEKERAAKPEG
FETIKANGKGLEGLEYRMQVSVMDCTGCSNCANICPAKNKALVMKPLAEEEAQSKNWDYA
VDNVSTKHGLMDQFSVKGSQFKQPLLEFHGACAGCGETAYATLVTRLFGDRMMIANASGC
SSIWGGSYPTAGFTYNEKGKGPTWASSLFEDNANYGYGMALGTRKLREQAEDYMKKFIEL
NAGTDFTPLFKEWIENKKDVEANTLTCDKIKALFDAHQSPRNTAVKNTDAADYLPVPESH
TFKYDTGNIEADRLLEYIYKLKDFIVKKSVWSFGGDGWAYDIGYGGLDHTMASGEDFNIL
VFDTEVYSNTGGQSSKSTPTAAVAKFAAGGKRIRKKDLGAMLMTYGYVYVAQVAIGSNMS
QFVKAVKEAESYDGPSIVICYAPCINHGLRSGMSRSVEQEKKAVEAGYWHLYRFDPRLKA
EGKNPFQLDSKEPSASFQDFINSEVRYTSLKKTFPDVAEVLFKRAEEDAKERYNRYKMLS
N
Download sequence
Identical sequences A0A0E2EI86
WP_002683794.1.67935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]