SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E2GM17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2GM17
Domain Number 1 Region: 739-961
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.79e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.02
Further Details:      
 
Domain Number 2 Region: 55-206
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000265
Family Pyruvate oxidase and decarboxylase Pyr module 0.059
Further Details:      
 
Domain Number 3 Region: 455-632
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000589
Family Pyruvate oxidase and decarboxylase PP module 0.026
Further Details:      
 
Domain Number 4 Region: 276-376
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000785
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.081
Further Details:      
 
Weak hits

Sequence:  A0A0E2GM17
Domain Number - Region: 648-702
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0225
Family Short-chain ferredoxins 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E2GM17
Sequence length 1159
Comment (tr|A0A0E2GM17|A0A0E2GM17_ACIRA) Uncharacterized protein {ECO:0000313|EMBL:ENV89058.1} KW=Complete proteome OX=981334 OS=Acinetobacter radioresistens DSM 6976 = NBRC 102413 = CIP 103788. GN=F939_01781 OC=Moraxellaceae; Acinetobacter.
Sequence
MNISTKFTPNKILTKDVSLEDKYLSDNGTAYMTGIQALVRLPLAQIRRDTLNGYHTAGFI
SGYRGSPLGNYDNFLWQAENILKDHHVVFQPGVNEDLAATAIWGTQQANLAGQGKYDGVT
AWWYGKGPGVDRSGDVLRHANLAGTSKQGGVVAFFGDDHSCKSSSIPHQSEHVMIGCGIP
IFYPTSIQHILDLGAHAVAMSRFAGVWTSMKLVSEIVETSASVHVNLDRVIPVLPKNIQM
PEDGVNIRWPDHGIQQEERLYKYRLPAVLAYARENELNQVTWHCPDARIGIVASGKGYLD
TIEALRILGIEGQTAQQLGLRVYQVALIWPLEPQGLREFAEGLEELIVVEEKRPILEAQI
KDELYALSDAKRPRVIGKACDGKGEWSTSIDEAPLIGHYEFQPEPIAKMLAARFLKLEIP
ESLKTQIQNRVELLEKAEQESRRVLDIAERKPFFCSGCPHNSSTALPEGSRALGGIGCHF
IAVSLDRGTETFSQMGGEGVSWAGASHFTNEKHIFANLGDGTYFHSGYLAIRQAIAAKLN
ITYKILYNDAVAMTGGQHVDGHLSVAQLTRQLDAEGIKKQVIVTDEPELIHTEEGIAPHV
EIYHRNELDDVQRKLREISGVTALIYVQTCASEKRRRRKRNAYPDIAERVFINTDICEGC
GDCSRKSNCLSVEPVETALGTKRQINQSSCNKDFSCVEGFCPSFVTVHTRDMKRPEIFKG
IEAGWPEKPILPELDQQPVRIMVGGVGGTGVVTAGALLGMAAHLEGKAARIMDMAGLAQK
GGTVYSYVQLATEDDQISATKIPAGQCNLLIGADPIVAGSNAALSRLKAEAMVIVNEDGS
PTSDFLESRDWYAPITDLINRLRNRTTQGKLLSLPVTRIATLVLGDAIFANQILLGMAWQ
SGQIPLNRESIEKAIYLNATAAEKNLEAFRIGCHLMSDPDLAKRIIATITVKNKPATLAE
LVEDRSSRLVEYWNQDYAAQYRALVEQAAKVLPEDLAETIATQLYRVMAYKDEYEVARLL
TGKSFKQSIEAQFGQGLRLTYHLAPPALGAHGTIRKRAFGYWMRIPMMILGRLQWLRETF
LDPFALQQERQKEQAWRDRYITFVKSITSAPENYDLSVAQQIAKLPADVRGFGPVKMQAM
ETAIQCWDELSLSLHRADQ
Download sequence
Identical sequences A0A0E2GM17
WP_005025891.1.36433 WP_005025891.1.37436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]