SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2M175 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2M175
Domain Number 1 Region: 11-212
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.5e-54
Family PP-loop ATPase 0.00021
Further Details:      
 
Domain Number 2 Region: 346-424
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000759
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.032
Further Details:      
 
Weak hits

Sequence:  A0A0E2M175
Domain Number - Region: 224-302
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00178
Family MesJ substrate recognition domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E2M175
Sequence length 436
Comment (tr|A0A0E2M175|A0A0E2M175_LACCA) tRNA(Ile)-lysidine synthetase {ECO:0000256|HAMAP-Rule:MF_01161} KW=Complete proteome OX=1378069 OS=Lactobacillus casei 5b. GN=N422_02905 OC=Lactobacillus.
Sequence
MSPKLFQRFGFAPHTRVLVAVSGGVDSMVLLNLAVKAADLDVVVATFDHRLRPESQQEQA
FVVAAAQQLQVPVVTGQWRRSDGQPTSEAAARQARYAFLAATAAEQHAEVVMTAHHADDQ
LETILFRLARSGDPAALIGIRADRTWHGRRLVRPLLPYSKAMIRSYADQHNVRFCEDSSN
ADPHYARNQLRHQVIPAFKKQNTQLLAHIQTFTMEQTGLLALAEAQLAEWLQRLQVDDAT
VNWRVASPQPEAVQRLLLKKILQQWQPNVDRQLLSPVLASLSGTKERRFDLGGGISIAVQ
SEQIVRLTRQAPVKPVTFTKLDQQHRTTRGIFSLQTSVAADKGTPVRVKLPITLRTRQAG
DVVQLPNGVIQKLRRFLINTKIPAYQRDQLLVLARGHQVFWVEGQPLERLSAIDQTDILH
VVLVQSPDVDKSEDKS
Download sequence
Identical sequences A0A0C9QGZ8 A0A0E1PL43 A0A0E2M175 A0A2I5ML55
WP_003606035.1.26583 WP_003606035.1.3518 WP_003606035.1.46604 WP_003606035.1.58515 WP_003606035.1.6012 WP_003606035.1.72586 WP_003606035.1.82183 WP_003606035.1.90364 WP_003606035.1.91826 WP_003606035.1.96019 WP_003606035.1.9892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]