SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E2PC76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2PC76
Domain Number 1 Region: 151-336
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.27e-57
Family Methylesterase CheB, C-terminal domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 1-135
Classification Level Classification E-value
Superfamily CheY-like 5.41e-28
Family CheY-related 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E2PC76
Sequence length 348
Comment (tr|A0A0E2PC76|A0A0E2PC76_RHOCA) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1415161 OS=Rhodobacter capsulatus Y262. GN=U715_10210 OC=Rhodobacteraceae; Rhodobacter.
Sequence
MTPKRVLIVDDSPTIRALIRTKLAADPRIVVVGEASDPFEAREKIKALSPDVLTLDVEMP
RMNGLEFLEKLMRLRPMPVVMISTETQKGSAAALEALSLGAVECVGKPSFDRLSDTFLNL
AELLVAAANARLRSPGPRAQIAPAQDFKWNGKVVLIGSSTGGVDALETLLSGYPRNCPPT
LITQHMPEGFLASFARRLDGRMVPTVELARDGAPLVPGTVYLAPGGDYHLAVSPSDPPRC
KLVASDKRNGHRPSVEVLFESAVPIAQKVVSVMLTGMGRDGAEAMKRLRQAGARCLAQDE
ATCVVFGMPRAAIEIGAAEKAVPIGKMSQSVLQLCAGSQMQFKSSRRE
Download sequence
Identical sequences A0A0E2PC76 D5AU65
gi|294677296|ref|YP_003577911.1| WP_013067483.1.101009 WP_013067483.1.32208 WP_013067483.1.44490 WP_013067483.1.45363 WP_013067483.1.45955 WP_013067483.1.65902 WP_013067483.1.82813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]