SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E2PLY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2PLY9
Domain Number - Region: 74-213
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0209
Family Capz alpha-1 subunit 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E2PLY9
Sequence length 447
Comment (tr|A0A0E2PLY9|A0A0E2PLY9_9STRE) 3-isopropylmalate dehydrogenase {ECO:0000313|EMBL:ETE05517.1} KW=Complete proteome OX=1415759 OS=Streptococcus pseudopneumoniae 22725. GN=U751_06405 OC=Streptococcus.
Sequence
MTMKAMKTMMRITDNQHKIIKEKFVEEYPKLSNLLLDRTLESLSQDERIFIFPNDLTHTP
DLDKDQKIFETVNQKIKTGNVIGFLGYGQERLTISSRFSDESNDHFLHYLLNKVLHINLT
SLDVALSREERLYQLLMYLFPKYLQAAIRKGLYKEYQRFSHNDSHVKGVIDVRNHLKKNL
PFTGNIAYTTREFTYDNPLMQLVRHTIEYIKNQKSIGQGVLDNLSTSRENVSEIVRVTPS
YKLADRAKITRRNQSKPIRHAYFHEYRNLQELCLMILNQEKHGLGYQDQKIYGILFDVAW
LWEEYVYTLLPKGFVHPRNKDKTDGISVFSVGKRKVYPDFYDRERKIVLDAKYKKLELTE
KGINREDLFQLISYSYILKAEKAGLVFPSKDKVIDNEMGNLAGYGAQLKKWSIRIPQNAS
FYSAFCKMMENSEENFKAIIDEEVGRK
Download sequence
Identical sequences A0A0E2PLY9 A0A0T8TKH8
WP_023936508.1.101287 WP_023936508.1.11079 WP_023936508.1.11409 WP_023936508.1.13118 WP_023936508.1.14384 WP_023936508.1.14461 WP_023936508.1.15779 WP_023936508.1.18130 WP_023936508.1.19236 WP_023936508.1.19995 WP_023936508.1.22497 WP_023936508.1.24315 WP_023936508.1.28549 WP_023936508.1.28680 WP_023936508.1.33749 WP_023936508.1.37170 WP_023936508.1.38355 WP_023936508.1.41360 WP_023936508.1.42232 WP_023936508.1.47819 WP_023936508.1.49407 WP_023936508.1.49575 WP_023936508.1.51089 WP_023936508.1.52443 WP_023936508.1.52988 WP_023936508.1.57772 WP_023936508.1.59109 WP_023936508.1.59552 WP_023936508.1.6207 WP_023936508.1.633 WP_023936508.1.63846 WP_023936508.1.64739 WP_023936508.1.65063 WP_023936508.1.66687 WP_023936508.1.67748 WP_023936508.1.68002 WP_023936508.1.70150 WP_023936508.1.71673 WP_023936508.1.7635 WP_023936508.1.77785 WP_023936508.1.80070 WP_023936508.1.8510 WP_023936508.1.85274 WP_023936508.1.86685 WP_023936508.1.88433 WP_023936508.1.89862 WP_023936508.1.91154 WP_023936508.1.91878 WP_023936508.1.93253 WP_023936508.1.93785 WP_023936508.1.94526 WP_023936508.1.96415 WP_023936508.1.96595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]