SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E2S759 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2S759
Domain Number 1 Region: 3-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.53e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E2S759
Sequence length 180
Comment (tr|A0A0E2S759|A0A0E2S759_BACFG) Pyruvate ferredoxin/flavodoxin oxidoreductase family protein {ECO:0000313|EMBL:EXY41565.1} KW=Complete proteome OX=1339308 OS=Bacteroides fragilis str. 3774 T13. GN=M117_1450 OC=Bacteroides.
Sequence
MKEEIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDKIS
SPILSKYDTAIILNQPSLEKFESRVKPGGILIYDGYGIINPPTRKDIKVYRIDAMDAANE
MNNAKAFNMIVLGGLLKLRPIVTLENVVKGLKKTLPERHHHLIPMNEEAIKKGMELIREA
Download sequence
Identical sequences A0A015SDS1 A0A015SEZ1 A0A015TVQ9 A0A015VCJ3 A0A015VFJ2 A0A015VZ23 A0A015WXS8 A0A015XBW7 A0A015XIN4 A0A015YFB9 A0A016AXQ4 A0A016CRN6 A0A016DMV7 A0A016EGX3 A0A016GAM3 A0A017NE64 A0A017P0G4 A0A0E2AF11 A0A0E2ARY2 A0A0E2S759 A0A0E2SVU0 A0A0E2TQ29 A0A0K6BTB8 A0A139T7N4 D1JKU9 E1WTW0 F7LNQ2 I9VWV0 K1FR87 Q5LEU7 Q64VT3 R6ZB51
gi|375357955|ref|YP_005110727.1| 272559.BF1652A 295405.BF1645 gi|53712935|ref|YP_098927.1| WP_005786493.1.10040 WP_005786493.1.100686 WP_005786493.1.10083 WP_005786493.1.101046 WP_005786493.1.10405 WP_005786493.1.11335 WP_005786493.1.15557 WP_005786493.1.18542 WP_005786493.1.2011 WP_005786493.1.21107 WP_005786493.1.21713 WP_005786493.1.21908 WP_005786493.1.22050 WP_005786493.1.23698 WP_005786493.1.26260 WP_005786493.1.26832 WP_005786493.1.26934 WP_005786493.1.30158 WP_005786493.1.30608 WP_005786493.1.31541 WP_005786493.1.32651 WP_005786493.1.33107 WP_005786493.1.34692 WP_005786493.1.35533 WP_005786493.1.35582 WP_005786493.1.35818 WP_005786493.1.36984 WP_005786493.1.37052 WP_005786493.1.37988 WP_005786493.1.38746 WP_005786493.1.39779 WP_005786493.1.40326 WP_005786493.1.40404 WP_005786493.1.4066 WP_005786493.1.42362 WP_005786493.1.43770 WP_005786493.1.43857 WP_005786493.1.44936 WP_005786493.1.456 WP_005786493.1.46679 WP_005786493.1.48703 WP_005786493.1.49420 WP_005786493.1.49748 WP_005786493.1.50677 WP_005786493.1.50935 WP_005786493.1.51373 WP_005786493.1.5142 WP_005786493.1.51489 WP_005786493.1.51763 WP_005786493.1.52936 WP_005786493.1.53885 WP_005786493.1.53910 WP_005786493.1.53995 WP_005786493.1.54019 WP_005786493.1.55270 WP_005786493.1.56204 WP_005786493.1.57121 WP_005786493.1.58084 WP_005786493.1.60699 WP_005786493.1.60854 WP_005786493.1.6251 WP_005786493.1.63108 WP_005786493.1.63590 WP_005786493.1.63925 WP_005786493.1.65409 WP_005786493.1.65726 WP_005786493.1.65921 WP_005786493.1.66858 WP_005786493.1.66941 WP_005786493.1.69826 WP_005786493.1.73957 WP_005786493.1.75176 WP_005786493.1.75668 WP_005786493.1.7580 WP_005786493.1.76253 WP_005786493.1.77492 WP_005786493.1.78347 WP_005786493.1.81678 WP_005786493.1.85293 WP_005786493.1.87523 WP_005786493.1.88754 WP_005786493.1.89424 WP_005786493.1.89499 WP_005786493.1.89819 WP_005786493.1.91045 WP_005786493.1.91849 WP_005786493.1.93484 WP_005786493.1.93759 WP_005786493.1.9461 WP_005786493.1.94953 WP_005786493.1.95091 WP_005786493.1.95195 WP_005786493.1.95750 WP_005786493.1.97349 WP_005786493.1.97365 WP_005786493.1.97964 WP_005786493.1.98903 WP_005786493.1.9932 YP_098927.1.45732 gi|60681147|ref|YP_211291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]