SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E3C238 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3C238
Domain Number 1 Region: 724-936
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.22e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.01
Further Details:      
 
Domain Number 2 Region: 17-236
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.06e-16
Family Pyruvate oxidase and decarboxylase Pyr module 0.058
Further Details:      
 
Domain Number 3 Region: 441-624
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000406
Family Pyruvate oxidase and decarboxylase PP module 0.043
Further Details:      
 
Domain Number 4 Region: 265-397
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000128
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3C238
Sequence length 1161
Comment (tr|A0A0E3C238|A0A0E3C238_COMTE) MFS transporter {ECO:0000313|EMBL:KGH12855.1} KW=Complete proteome OX=285 OS=Comamonas testosteroni (Pseudomonas testosteroni). GN=P608_09455 OC=Comamonadaceae; Comamonas.
Sequence
MTHPVSLADKYELPAGRVYMNGTQALVRLLLAQKARDEAAGLNTEGFVSGYRGSPLGAVD
QELWRNRVLLDKHKVRFQPGLNEELAATSVWGTQMVSLDPKARVDGVFALWYGKGPGVDR
SGDVFKHGNIAGGASHGGVLLVAGDDHACKSSSLPHQSEHAFIAAMIPVLHPSGVHEFIE
FGLHGYAMSRYSGCWVGFKVISDTVESSSSFDIDPMSVEIKIPQSYPVPADGFSIRWPDP
PLEQENRLQRERLYALLEYVRLNKLNRQDWMAPDARLGICTTGKSYLDVREALSLLGLDE
AAAQALGVRLLKIGVVWPLEPTCVVEFAQGLDEILVVEEKRQVLEYQIKEHLYNEPHRPR
VVGKYDESGEWVQVPSSGILLSPNGELTPAGIADVIAARLVKVFGHGELPESVREWLERQ
TAAAPRSPSDAPVPQRLPYFCSGCPHNTSTQVPEGSRALAGIGCHYMSMWMDRRTETFSQ
MGGEGVPWIGQAPYTDTPHVFANLGDGTYMHSGSLAIRAAVAAGVNITYKLLVNDAVAMT
GGQPVEGAPSVPQLLRQIAAEGVTELHLVSDEPEAFQALDDFPEDVKVSHRDGMDALQRQ
LREVKGVSVIVYAQTCAAEKRRRRKKKTLVDPARRVVINEEVCEGCGDCGVQSNCVSILP
LETPLGRKRQIDQSGCNKDFSCVRGFCPSFVVLEGAELRKPQRDRVAPPTGLAQPELPAL
ARPWNILVAGVGGTGVVTIGALMGMAAHLEGKGVLVLDMAGLAQKGGAVMSHVRLAADPS
QLHAARVARGQADVVLGCDLMVAAAGDALASMAPGRTRAVLNTDVAPTGSFTRDPDWQAS
PDAMLERVGSAAAEVESLEASRLAVALMGDAVATNVFLLGFAWQKGWVPLQEDSLLRAIE
LNGAAVGMNRAAFAWGRQAALDPAAVRRAAGLPSNEKVMLMPSRTASLASVLADRTERLA
DYQNARYAQRYEAAVRRVADVEKARVGGERLAREVAVSLYKLMAYKDEYEVARLHTSSDF
LARLQERFEGDFTVSYYLAPPLLARRDAQGRPIKQRYGAWVQTAFRLLARLRFLRGTVFD
PFGWTRERREERAAIDEFEAMVEDLLKDLNSSNFSEALALARLPQQVRGYGHVKAREHDV
VQKKASELLARWRTKTSLPQG
Download sequence
Identical sequences A0A0E3C238
WP_052052693.1.14079 WP_052052693.1.48635 WP_052052693.1.87060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]