SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3GWC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3GWC1
Domain Number 1 Region: 37-158
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 7.6e-48
Family Insert subdomain of RNA polymerase alpha subunit 0.0011
Further Details:      
 
Domain Number 2 Region: 2-42,180-261
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.14e-27
Family RNA polymerase alpha subunit dimerisation domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3GWC1
Sequence length 265
Comment (tr|A0A0E3GWC1|A0A0E3GWC1_SULSF) DNA-directed RNA polymerase subunit D {ECO:0000256|HAMAP-Rule:MF_00320} KW=Complete proteome OX=2287 OS=Sulfolobus solfataricus. GN=SSOP1_0069 OC=Sulfolobus.
Sequence
MSINLLHKDDTRIDLVFEGYPLEFVNAIRRASMLYVPIMAVDDVYFIENNSPLYDEILAH
RLALIPFMSEEALDTYRWPEECIECTENCEKCYTKIYIEAEAPNEPRMIYSKDIKSEDPS
VVPISGDIPIVLLGTNQKISLEARLRLGYGKEHAKFIPVSLSVVRYYPKVEILANCEKAV
NVCPEGVFELKDGKLSVKNELSCTLCEECLRYCNGSIRISFVEDKYILEIESVGSLKPER
ILLEAGKSIIRKIEELEKKLVEVVK
Download sequence
Identical sequences A0A0E3GWC1 D0KRC6 P95989
gi|384433538|ref|YP_005642896.1| WP_009988881.1.14611 WP_009988881.1.22626 WP_009988881.1.43719 WP_009988881.1.57434 WP_009988881.1.66040 WP_009988881.1.8449 WP_009988881.1.93834 gi|15897038|ref|NP_341643.1| 273057.SSO0071 2pa8_D 2pmz_D 2pmz_S 3hkz_D 3hkz_O

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]