SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E3HAF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3HAF4
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.62e-53
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E3HAF4
Sequence length 182
Comment (tr|A0A0E3HAF4|A0A0E3HAF4_METTE) Pyruvate:ferredoxin oxidoreductase, gamma subunit {ECO:0000313|EMBL:AKB15759.1} KW=Complete proteome OX=1434121 OS=Methanosarcina thermophila CHTI-55. GN=MSTHC_1441 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MKEIRIHGRGGQGSVTAAELLAVAAFEDGKFSQAFPAFGVERRGAPVQAFTRISDRPIRL
RSQIYTPDYVIVQDATLLETVDVASGIKDDGIIIVNTTEAPESLKLNTKARVMTVDATKV
AMDIIGVPIVNTVLLGAFAGATGEINVESIKHAIMARFPGRVGEKNANAIQKAYKLIRGE
EA
Download sequence
Identical sequences A0A0E3HAF4 A0A0E3KZ41 A0A0P0JAT8 A0A1I6ZHY3
WP_048167607.1.37671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]