SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3KCC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3KCC2
Domain Number 1 Region: 15-133
Classification Level Classification E-value
Superfamily DsrEFH-like 3.36e-22
Family DsrH-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E3KCC2
Sequence length 133
Comment (tr|A0A0E3KCC2|A0A0E3KCC2_SULSF) Sulfur reduction protein DsrE {ECO:0000313|EMBL:AKA77018.1} KW=Complete proteome OX=2287 OS=Sulfolobus solfataricus. GN=SSOP1_1154 OC=Sulfolobus.
Sequence
MAQAQTQGQEEEQKKKILIVVTHGPEDLDRTYAPLFMASISASMEYETSVFFMIKGPKLL
DKKWQEEERKKGGNPFIHFFDMAKENGVKMYVCVQSLKDMCHMKEDDVVEGIELVGGSTL
IDLTLEADRTLFF
Download sequence
Identical sequences A0A0E3KCC2 D0KU83 Q97Z18
273057.SSO1125 gi|15897984|ref|NP_342589.1| gi|384434545|ref|YP_005643903.1| 381769 WP_009989755.1.14611 WP_009989755.1.22626 WP_009989755.1.43719 WP_009989755.1.57434 WP_009989755.1.66040 WP_009989755.1.8449 WP_009989755.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]