SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E3LF09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3LF09
Domain Number 1 Region: 158-342
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-58
Family Methylesterase CheB, C-terminal domain 0.0000119
Further Details:      
 
Domain Number 2 Region: 1-122
Classification Level Classification E-value
Superfamily CheY-like 3.13e-27
Family CheY-related 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3LF09
Sequence length 350
Comment (tr|A0A0E3LF09|A0A0E3LF09_METMZ) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1434117 OS=Methanosarcina mazei WWM610. GN=MSMAW_0960 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MIRTLIVDDSAFMRMAIRSMLASSPDIKIAGDACNGKEAVDKSKSLHPDIIIMDVNMPVM
DGLTAVKTIMSTDPVPIIMFSTLTVEGSKEALEALQLGAIDFVPKSESHHDVNKIEKELV
DKIRNIHSSNPSILRLINMRKFKGEVVRGKWSCAGDFAVLIGSSTGGPSSLEQVIPRLPG
DLPAPVFVVQHMPEGNFCKQLAERLNFLSELEIKEARNNEKVTAGVVYIAPGGYHMTVKK
ALGVTRIKLIKSQPVHAVMPAVDVIAESMLDVYGKNIVAAILTGMGFDGAAGFKKIRDAG
GSTIACSEDTCVIFGMPKAAIAAGGIDTVKPIFEIPEEIVRMSEVKCNGK
Download sequence
Identical sequences A0A0E3LF09 A0A0E3RIY6 A0A0E3RSS5 A0A0F8H645 M1Q0I0
WP_011032283.1.12270 WP_011032283.1.14209 WP_011032283.1.14583 WP_011032283.1.16483 WP_011032283.1.18729 WP_011032283.1.18783 WP_011032283.1.2157 WP_011032283.1.21629 WP_011032283.1.21918 WP_011032283.1.29103 WP_011032283.1.29761 WP_011032283.1.33522 WP_011032283.1.40449 WP_011032283.1.41322 WP_011032283.1.43564 WP_011032283.1.43834 WP_011032283.1.49674 WP_011032283.1.53770 WP_011032283.1.61041 WP_011032283.1.61670 WP_011032283.1.62876 WP_011032283.1.63409 WP_011032283.1.64722 WP_011032283.1.65224 WP_011032283.1.66913 WP_011032283.1.7135 WP_011032283.1.73711 WP_011032283.1.75785 WP_011032283.1.76299 WP_011032283.1.7642 WP_011032283.1.76508 WP_011032283.1.84394 WP_011032283.1.90340 WP_011032283.1.95514 192952.MM_0329 gi|452208943|ref|YP_007489057.1| gi|161485682|ref|NP_632353.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]