SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E3NLR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3NLR4
Domain Number 1 Region: 197-452
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.11e-62
Family PFOR Pyr module 0.049
Further Details:      
 
Domain Number 2 Region: 8-222
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.32e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0055
Further Details:      
 
Domain Number 3 Region: 469-578
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000002
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E3NLR4
Sequence length 579
Comment (tr|A0A0E3NLR4|A0A0E3NLR4_9EURY) 2-oxoglutarate oxidoreductase, alpha subunit {ECO:0000313|EMBL:AKB17900.1} KW=Complete proteome OX=1434103 OS=Methanosarcina sp. WWM596. GN=MSWHS_1037 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MEVKILDYTLRIGGEAGQGLQTIGGALAKIFSRTGYHVFTHQDYMSMVRGGHNFYQIRFS
DQKVSASRDMVDILLALDLNTIEIHKKSVRDDGFILYDSETIKKKFEGPEFIDVPFKKIA
LDAGKSSIMANTVATGAVLGILDLGLERLKEILKSTFKKKGNEIIEKNIACAKAGYDYVL
SNCPRCEAVEIQEPEEKKLMLIDGIQAIGMGALMSGCKFYSAYPMTPSTGILNYLASKAE
EYGLVVEQAEDEIAAINMAIGASFAGVRAMTGSSGGGFALMVEGLSLAGMTETPLVIAEV
QRPGPATGLPTRTEQADLLFILYAGHGEFPRVIFEPGTPKQAFYLTNRAFELAEKYQIPV
FIQSDQYLGDSEWTFENFNFEHLIYNDYRLREKDLEGVEEYKRYKYSDTGISLFAVPGEA
GKHLVVADSDEHDEEGHLIEDSETRIRMVQKRLLKKMPLIKEEIEAPLMYGDPSPEIVLV
GHGSTYGAIKEVVDILSKDRKIAMMHFSQIYPLSKRDRFDYIELLKNAKLAISIENNATG
QFAELIRAETGFEFTHQILRYDGRPFTIENLKEEVDAYL
Download sequence
Identical sequences A0A0E3KWU3 A0A0E3NLR4
WP_048126689.1.35945 WP_048126689.1.44353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]