SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E3NXS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3NXS7
Domain Number 1 Region: 153-408
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.16e-61
Family PFOR Pyr module 0.068
Further Details:      
 
Domain Number 2 Region: 2-178
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.83e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0059
Further Details:      
 
Domain Number 3 Region: 426-531
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000428
Family Transketolase C-terminal domain-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E3NXS7
Sequence length 535
Comment (tr|A0A0E3NXS7|A0A0E3NXS7_9EURY) 2-oxoglutarate oxidoreductase, alpha subunit {ECO:0000313|EMBL:AKB25739.1} KW=Complete proteome; Reference proteome OX=1434100 OS=Methanosarcina sp. MTP4. GN=MSMTP_2270 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MSRIRGGHNFYQVRFSDRRVTASRDVLDILVALDLNTIETHRKSLGEEGIILYDSESIKK
TFEEPEFIDVPFKKIALDVGKNRVMVNTVATGAVLGILGMGLEALEGILKTAFKKKGDEI
IEKNIACARAGYDYALSSCPRCEAFRLEETGNRKLMLINGLQAIGLGALMSGCKYYSAYP
MTPSTGIMNFLASKAGEHGIIVEQAEDEVAAINMAIGASFAGARAMTGTSGGGFALMVEG
LSLAGMTETPIVIAEIQRPGPATGLPTRTEQADLLFVLYAGHGEFPRVIFDPGTPKQAFH
LTNKAFELAEKYQVPIFIQSDQYLGDSQWTFEGFDPGRLIYNDYRLREADLEGSGEYKRH
ALSGTGVSLLAVPGEAGKHLVVTDSDEHDEKGHIIEDSETRIEMVRKRLLEKMPLIRKEM
EAPYLYGDASPKIVLVGHGSTYGVIREVVDIFSKEQKISMLHFSEIYPLPESDRFDYLDL
LENADLAICIENNASGQFAKLFRAETGFEFTHLITRYDGRPFTIESLKEDLHAYI
Download sequence
Identical sequences A0A0E3NXS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]