SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3PGL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3PGL9
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily DsrEFH-like 5.23e-22
Family DsrEF-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3PGL9
Sequence length 114
Comment (tr|A0A0E3PGL9|A0A0E3PGL9_9EURY) Uncharacterized protein involved in the oxidation of intracellular sulfur {ECO:0000313|EMBL:AKB33889.1} KW=Complete proteome OX=1434119 OS=Methanosarcina siciliae HI350. GN=MSSIH_3199 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MESVFYLLDTAPYGSEKSFGTLNAAAVSLDRIDVTLGLYGDGVYLVAAGQDSTELGLPNL
SDILYSYGELKVLVHELSLVERGLFEETLIETIELVDEEDFLEAMESSDCVILF
Download sequence
Identical sequences A0A0E3PA15 A0A0E3PGL9
WP_048173748.1.43275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]