SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E3RYG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3RYG6
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-53
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3RYG6
Sequence length 182
Comment (tr|A0A0E3RYG6|A0A0E3RYG6_METMZ) Pyruvate:ferredoxin oxidoreductase, gamma subunit {ECO:0000313|EMBL:AKB73234.1} KW=Complete proteome OX=1434113 OS=Methanosarcina mazei C16. GN=MSMAC_3344 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MKEIRIHGRGGQGSVTAAEMLSVAAFEDGKFSQAFPAFGVERRGAPVQAFTRISDSPIRL
RSQIYAPDYVIVQDATLLETVDVASGIKDDGIIIVNTTEKPESLKLNTKAKVMTVDATKV
AMDVMGIPIVNTVLLGAFAGATGEINVESIQKAIRARFSGKIGEKNAKAIQKAYQLIRGE
KE
Download sequence
Identical sequences A0A0E3Q1T7 A0A0E3RYG6 A0A0F8D6A3 M1P8I1
gi|452209925|ref|YP_007490039.1| WP_015411749.1.12270 WP_015411749.1.14209 WP_015411749.1.14583 WP_015411749.1.18729 WP_015411749.1.18783 WP_015411749.1.2157 WP_015411749.1.21629 WP_015411749.1.21918 WP_015411749.1.23878 WP_015411749.1.29103 WP_015411749.1.33522 WP_015411749.1.43564 WP_015411749.1.43834 WP_015411749.1.53770 WP_015411749.1.61041 WP_015411749.1.62876 WP_015411749.1.64722 WP_015411749.1.7135 WP_015411749.1.73711 WP_015411749.1.75785 WP_015411749.1.7642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]