SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3S5C4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3S5C4
Domain Number 1 Region: 141-269
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.44e-29
Family Cobalamin (vitamin B12)-binding domain 0.00054
Further Details:      
 
Domain Number 2 Region: 58-140
Classification Level Classification E-value
Superfamily Methionine synthase domain 3.53e-17
Family Methionine synthase domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3S5C4
Sequence length 275
Comment (tr|A0A0E3S5C4|A0A0E3S5C4_9EURY) Methylthiol:coenzyme M methyltransferase corrinoid protein {ECO:0000313|EMBL:AKB74113.1} KW=Complete proteome OX=1434111 OS=Methanosarcina lacustris Z-7289. GN=MSLAZ_0852 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MIRHIDLAVQKIFEFKEKEPAKFKKLIDEGIMIGLGVDLGDRNKEITTADQIKEKNRPKD
PEYAAVAEAVIEGNRAEAAKLTADLLEKGRDPTDLVLNALMHGIQTVCELYDIGESYVPE
ILLANEALLGGVELCQEKIGDIPSQGKVVSLVIVGDLHDIGKNIVAAILRANGFEVIDLG
RDITVEAAVEAVKAEKANLVTGTTLMSTTKVGLKALAEALESEGVPVACGGAAVDSHFVE
TFGNSLYGKTPLDAVKIAKKICAGKSWEEARKELH
Download sequence
Identical sequences A0A0E3S5C4
WP_048124885.1.75967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]