SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E3VXS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3VXS4
Domain Number 1 Region: 720-952
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.66e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0081
Further Details:      
 
Domain Number 2 Region: 49-228
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.88e-17
Family Pyruvate oxidase and decarboxylase Pyr module 0.034
Further Details:      
 
Domain Number 3 Region: 438-622
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000383
Family PFOR PP module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3VXS4
Sequence length 1163
Comment (tr|A0A0E3VXS4|A0A0E3VXS4_9BRAD) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:BAR63165.1} KW=Complete proteome OX=1355477 OS=Bradyrhizobium diazoefficiens. GN=NK6_10033 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MGINQGPISLDQKYTQDTGHVFTTGIQALVRLPMAQIRRDRANGLNTAGFISGYRGSPLG
GYDQQLFAARKHLEQYNIKFQPGVNEDLAATAVWGSQQLNLSPGAKYDGVVGIWYGKGPG
VDRCGDVFRHGNAAGSAKNGGVLCLAGDDHGAKSSTVPHQSDHAFMSALMPYLYPSSIHE
MIEMGLLGIAMSRYSGCWVGMKVITETVETTAEIDLTDEMKPFIIPPDFELPPGGLNLRW
PDDRFEQDRRLQDYKGFAAIAFARANRVNRVTMDSPNARFGIMASGKSYEDVRQALRELG
VTEEVAAKIGLRLYKIGMPWPLEPEGVRQFAVGLEEIFIIEERREIVENQVKQELFNWRD
DVRPRIVGKMDEHDKRFLTFAAELSVASLATSITERLLRLNLNPEIAEMLRVKADWFNGR
QATQMQATAPVSRTPYFCSGCPHNTSTKVPEGSRALAGIGCHFMALWMDRSTETFTHMGG
EGVPWVGIAPFTNENHIFANLGDGTYFHSGLLAIRQAVASKTNITYKILYNDAVAMTGGQ
RHDGDLSPQQITFQLHAEGIREIYLVSEAPDTYPADTIAPGVKKYHRDELDNVMKMCREY
KGTSAIVFVQTCAAEKRRRRKRGLMEDPARRVMINPAVCEGCGDCSVQSNCISVEPLETE
FGRKRAINQSSCNKDYSCVKGFCPSFVTVDGGAPRHRAPAELEEIGALPEPASRPTLDKP
YNIAVGGVGGTGVLTIGALLGMAAHIEGKASMILDMSGLAQKGGAVLSHVRLSDHPAEVT
CSRIVTGTADLVLAADEVVAVAKDTISLCDSSRTRGIINSHVIPTADFVLNRDFNFQTRK
LNGLLETALHKDSVFFDFTKPAEQLLGDSIATNMMMMGYAYQKGLFPLAAESIEQAIEVN
GVAIKMNKEAFRLGRLAVADPERLAGMLKGTGEVVAPKTLDAMTLDEIVEHRAKHLTAYQ
NGRLAKRYRKLVDQVRDAARQGGYDDALPRAVAVNYAKLLAYKDEYEVARLFTDGAFEQQ
LRDQFEGDFKFSFNLAPPILASGVDALGRPKKRAFGPWMLKVFLVLAKFKFLRGTPLDIF
GRSADRKLERDLIVGYEKDVATVLGLLSPLTIDTAVELLSLPDRIRGYGPVKEKAVADAK
ARYAQLAADLASPPPAPRQIAAE
Download sequence
Identical sequences A0A0E3VXS4
WP_060912575.1.69380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]