SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3Y7D8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3Y7D8
Domain Number 1 Region: 9-99
Classification Level Classification E-value
Superfamily YccV-like 1.44e-28
Family YccV-like 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3Y7D8
Sequence length 110
Comment (tr|A0A0E3Y7D8|A0A0E3Y7D8_9ENTR) Heat shock protein HspQ {ECO:0000256|HAMAP-Rule:MF_01194, ECO:0000256|SAAS:SAAS00634478} KW=Complete proteome; Reference proteome OX=1505596 OS=Blochmannia endosymbiont of Polyrhachis (Hedomyrma) turneri. GN=BTURN675_408 OC=Enterobacteriaceae; ant endosymbionts; Candidatus Blochmannia.
Sequence
MSESFITASKFSIGQQVRHKLLGYLGVVIDVDPEYSLEKPSLDEITNNDTLRQSPWYHVV
MEDEEGKPIHTYLAEAQLGYEPIPTHSDQSTLDDLAESIRLQLQAPRLRN
Download sequence
Identical sequences A0A0E3Y7D8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]