SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3Y8D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3Y8D6
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 2.16e-17
Family H-NS histone-like proteins 0.00011
Further Details:      
 
Domain Number 2 Region: 93-135
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000000122
Family H-NS histone-like proteins 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E3Y8D6
Sequence length 135
Comment (tr|A0A0E3Y8D6|A0A0E3Y8D6_9ENTR) DNA-binding protein {ECO:0000256|PIRNR:PIRNR002096} KW=Complete proteome; Reference proteome OX=1505597 OS=Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus. GN=BOBLI757_438 OC=Enterobacteriaceae; ant endosymbionts; Candidatus Blochmannia.
Sequence
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDNQAQAEIEKHSRKLQQ
YRDMLIADGIDPNELLQSMSTIKFPNKIKRATRPAKYQYINNNGEIKTWTGQGRTPAIIK
KAIDKEGKKLEDFLL
Download sequence
Identical sequences A0A0E3Y8D6
WP_046305082.1.94479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]