SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3YFX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3YFX9
Domain Number 1 Region: 20-83
Classification Level Classification E-value
Superfamily XseB-like 2.22e-19
Family XseB-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3YFX9
Sequence length 90
Comment (tr|A0A0E3YFX9|A0A0E3YFX9_9BURK) Exodeoxyribonuclease VII small subunit {ECO:0000256|HAMAP-Rule:MF_00337} KW=Complete proteome OX=573737 OS=Pandoraea oxalativorans. GN=MB84_20855 OC=Burkholderiaceae; Pandoraea.
Sequence
MAKTAKSQDAAPEASQDLPETYEAALAELEQLVGRMEGGELGLEESLGAYRRGAVLVKYC
QGLLEKVEQQVKVLEGETLKPLEASSRDEF
Download sequence
Identical sequences A0A0E3YFX9
WP_046292520.1.11194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]