SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E4AHK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E4AHK8
Domain Number 1 Region: 60-97
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.000000000549
Family H-NS histone-like proteins 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E4AHK8
Sequence length 98
Comment (tr|A0A0E4AHK8|A0A0E4AHK8_BURCE) H-NS histone {ECO:0000313|EMBL:AKE02181.1} KW=Complete proteome OX=292 OS=Burkholderia cepacia (Pseudomonas cepacia). GN=XM57_03970 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MSQYAKLKAQIADLQAQADEVRRQEVATVIAEVQRMIAEYGLTAQDLGFAERARRGRPPK
KAPLPPKYRDPKSGATWSGRGKPPNWIVGKNRDRFLIE
Download sequence
Identical sequences A0A0E4AHK8 A2W604
WP_006762906.1.3886 WP_006762906.1.58874 WP_006762906.1.60412 WP_006762906.1.67275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]