SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E4CB21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E4CB21
Domain Number 1 Region: 465-552
Classification Level Classification E-value
Superfamily PilZ domain-like 0.00000196
Family PilZ domain 0.025
Further Details:      
 
Weak hits

Sequence:  A0A0E4CB21
Domain Number - Region: 141-199
Classification Level Classification E-value
Superfamily PilZ domain-like 0.000145
Family PilZ domain 0.019
Further Details:      
 
Domain Number - Region: 190-279
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00667
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E4CB21
Sequence length 779
Comment (tr|A0A0E4CB21|A0A0E4CB21_VIBCL) Uncharacterized protein {ECO:0000313|EMBL:CPR23834.1} OX=666 OS=Vibrio cholerae. GN= OC=Vibrionaceae; Vibrio.
Sequence
MQQTEILSLVERLIPVYRSGDLDYLLSQMTEGHPPSAKLLVKMELNRLMAPCTKSIDLRG
KVQGECREYHFDGRQHWLDDVAFNSYQKSLKKFGAYTEGVWEAVNNTRNNFRVMKQQGKL
DPKTDQPKDTSFEVEPVKLGYDLKRQENRLKISSQIEIHLKNEQLVHGLSVDLSPSGAKL
KVPAAFDYKLGEVIQVYFSDLNKTSNVVGLHKSIDYRILGVDESYDSDAIKFLRVLKLSD
TDVIEKVIEEAIQTNTQKARHDNQDKIIRARTRGYEHMYLKHTCNLPLFFSGNELKLALL
TENNRPIWQYWHDERNQQALGTLFKPERMAHLTAPGVRGSNNVLYAFKHEHQHKTLFFSM
LMPEATQEQRKLFWHIGAKRDSWKAFRLFVFELSDEERQTLAGHSRELANQSSSLTHCGV
LQEISDIEAAHDYLLVEKPNLPSSALNDFRHPRQVVGTPMGIYFDARSRRKEPRYRFRTP
VQVSKDALKVTGATVDISKRGLSLLLDAPLDVKANDQVWVDYLELKLYDKNLPLDNAPYK
VVRIGPEGRRLQLVIEENLQTLKTITFFNGIIEHNQDKLLIKEEILPSNALLESLHNILL
DKMVSTPIFVEKVGSNLKPKVIGVNYPLPPHLALLAKLGSENRITLQPIFKGHTNSLLAT
PMKRIEGAVPQYHEVYLSAVKYGTRIQSVESRLLSDFADTRERIRFIRQGQAMGEFYALR
VSGVPVFAPITNLLRSDLTELAEISPHHAKSLEKEMLAQVGYGELVDITEEVLIRLELT
Download sequence
Identical sequences A0A0E4CB21
WP_001187863.1.23751 WP_001187863.1.32395 WP_001187863.1.42441 WP_001187863.1.81563 WP_001187863.1.95818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]