SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E9CKN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9CKN6
Domain Number 1 Region: 739-785
Classification Level Classification E-value
Superfamily MIR domain 0.000000392
Family MIR domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E9CKN6
Sequence length 810
Comment (tr|A0A0E9CKN6|A0A0E9CKN6_CHLTH) MAC/perforin family protein {ECO:0000313|EMBL:CRH53997.1} KW=Complete proteome OX=813 OS=Chlamydia trachomatis. GN=ERS082928_00328 OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
MTKPSFLYVIQPFSVFNPRLGRFSTDSDTYIEEENRLASFIESLPLEIFDIPSFMETAIS
NSPYILSWETTKDGALFTILEPKLSACAATCLVAPSIQMKSDAELLEEIKQALLRSSHDG
VKYRITRESFSPEKKTPKVALVDDDIELIRNVDFLGRAVDIVKLDPINILNTVSEENILD
YSFTRETAQLSADGRFGIPPGTKLFPKPSFDVEISTSIFEETTSFTRSFSASVTFSVPDL
AATMPLQSPPMVENGQKEICVIQKHLFPSYSPKLVDIVKRYKREAKILINKLAFGMLWRH
RAKSQILTEGSVRLDLQGFTESKYNYQIQVGSHTIAAVLIDMDISKIQSKSEQAYAIRKI
KSGFQRSLDDYHIYQIERKQTFSFSPKHRSLSSTSHSEDSDLDLSEAAAFSGSLTCEFVK
KSTQHAKNTVTCSTAAHSLYTLKEDDSSNPSEKRLDSCFRNWIENKLSANSPDSWSAFIQ
KFGTHYIASATFGGIGFQVLKLSFEQVEDLHSKKISLETAAANSLLKGSVSSSTESGYSS
YSSTSSSHTVFLGGTVLPSVHDERLDFKDWSESVHLEPVPIQVSLQPITNLLVPLHFPNI
GAAELSNKRESLQQAIRVYLKEHKVDEQGERTTFTSGIDNPSSWFTLEAAHSPLIVSTPY
IASWSTLPYLFPTLRERSSATPIVFYFCVDNNEHASQKILNQSYCFLGSLPIRQKIFGSE
FASFPYLSFYGNAKEAYFDNTYYPTRCGWIVEKLNTTQDQFLRDGDEVRLKHVSSGKYLA
TTPLKDTHGTLTRTTNCEDAIFIIKKSSGY
Download sequence
Identical sequences A0A0E9CKN6 O84155
gi|478457802|ref|YP_007730987.1| gi|15604872|ref|NP_219656.1| 272561.CT153 gi|478459605|ref|YP_007733673.1| gi|386262506|ref|YP_005815785.1| gi|478456890|ref|YP_007725483.1| gi|478474019|ref|YP_007730095.1| gi|478455083|ref|YP_007727273.1| NP_219656.1.57406 WP_010725096.1.101362 WP_010725096.1.13674 WP_010725096.1.30792 WP_010725096.1.37673 WP_010725096.1.38504 WP_010725096.1.38813 WP_010725096.1.4264 WP_010725096.1.55117 WP_010725096.1.67250 WP_010725096.1.69355 WP_010725096.1.71619 WP_010725096.1.74323 WP_010725096.1.75470 WP_010725096.1.77651 WP_010725096.1.86066 WP_010725096.1.93216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]