SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9ENA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9ENA9
Domain Number 1 Region: 10-69
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 3.79e-16
Family E6 C-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 82-143
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.0000000000000183
Family E6 C-terminal domain-like 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E9ENA9
Sequence length 150
Comment (tr|A0A0E9ENA9|A0A0E9ENA9_CHLTH) Early Protein (E6) {ECO:0000313|EMBL:CRH71739.1} OX=813 OS=Chlamydia trachomatis. GN=ERS095036_05939 OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
MSGTSASSQPRTLYQLCKEFGLTLRNLQISCIWCKKHLTGAEVLAYHFKDLVVVWRKDFP
YAACAFCLEFNSKICALRHYERSAFWYTVEKETGLLLEEQQIRCALCQKPLSQSEKNHHI
DTGTRFQFILCQWTGRCTHCRGQCVERRLP
Download sequence
Identical sequences A0A0E9ENA9 D0EDA9 P27229
D0EDA9_HPV42 VE6_HPV42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]